Os08t0559300-01

Locus

Os08g0559300

Description

O-linked N-acetylglucosamine transferase, Negative regulator of gibberellin (GA) signaling, Brassinosteroid (BR) synthesis

RAP-DB Gene Symbol Synonym(s)

SPY, OsSPY

RAP-DB Gene Name Synonym(s)

SPINDLY, Spindly, Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY

CGSNL Gene Symbol

SPY

CGSNL Gene Name

SPINDLY

Oryzabase Gene Symbol Synonym(s)

OsSPY

Oryzabase Gene Name Synonym(s)

Spindly, Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY

Transcript Evidence

AK065854

Protein Evidence

Q6YZI0

Literature

PMID: 17052323

Note

Manual Curation

January 29, 2016

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Tetratricopeptide repeat-containing domain (IPR013026)

Tetratricopeptide-like helical domain (IPR011990)

O-GlcNAc transferase, C-terminal (IPR029489)

Tetratricopeptide repeat (IPR019734)

Sel1-like repeat (IPR006597)

Tetratricopeptide repeat 1 (IPR001440)

Full-length cDNA

J013041I06 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0559300-01)

RiceXPro (AK065854)

Others

Oryzabase (6296)

KEGG (Os08t0559300-01)

Transcript

3546 bp

>Os08t0559300-01 O-linked N-acetylglucosamine transferase, Negative regulator of gibberellin (GA) signaling, Brassinosteroid (BR) synthesis
AAAGAAGGGAAAAAAAATACGAAAAGCAAAAAGGAATAAACGGAGGGGGCTAAACACCAA
AATTCCCCCTCTCCTTCTCCTTCCCCTCCTCCCGAAACCCTCGCCGCCGTCGCTGTCGAA
ACCCTCGCTGCTGCTGCTGCCGCACGGCGCGGCGGGGTACCGGGTCCCCCTCCCTGCGGC
GGCGCGGAGGGGTAGGTCTCCCCCCCCTCGCTGCGGCGTGGCGGTGGGGGGTGCGGTGCC
GGCTGCCGCGCCATGATCTTGCGCCGGTGGACTGCGCCTATCCAATAAAAAAAAAAGATA
AAGATAGAACAAGTAGGTTACTTTCCGTACCATGGGGCGACCGGGGATGGACTCCAGCGA
AGGGAGGGAGAGCAATGGCGTTGTTCCTGAACGTAATGGTGGTGCTGTCCCTGCAAAACA
GCAGTTGGACGGGAAGGACACCTTGCGGTACGCCAACATCCTCCGCTCCCGCAACAAATT
TGCCGAAGCACTCCAGTTGTACAATAATGTCCTTGAGAAGGATGAAGCCAATGTGGAGGC
CCTTATTGGCAAAGGGATTTGCCTCCAGGCACAGAGCCTACCTATGCAGGCCATCGAGTG
CTTCAACGAGGCCGTCAGGATCGACCCAGGGAATGCATGTGCTCTCACTTATTGTGGGAT
GATATACAAAGATGAGGGTCACTTAGTTGAAGCTGCAGAGGCTTATCAAAAAGCTCGAAA
TGCAGATCCTTCCTACAAACCTGCTGCAGAGTTTCTTGCTATTGTGTTGACCGATCTTGG
AACTAGCTTGAAGCTTGCAGGTAATACAGAGGAGGGGATTCAAAAATATTGTGAAGCTTT
GGAAGTTGACAGCCACTATGCGCCTGCTTATTACAACCTTGGTGTGGTTTACTCGGAGAT
GATGCAATTTGATTTGGCTCTTACTTGTTACGAGAAAGCTGCTTTGGAGAGGCCATTGTA
TGCTGAAGCTTATTGCAACATGGGAGTTATTTACAAGAATCGTGGAGAATTAGAAGCAGC
AATTGCCTGCTACGAGAGGTGCTTGACTATTTCCCCAAATTTTGAGATTGCCAAGAATAA
CATGGCAATAGCACTAACCGACTTGGGTACAAAGGTAAAAATTGAGGGTGACATTAATCA
AGGTGTGGCATATTACAAGAAAGCTCTGTTCTACAATTGGCACTACGCTGATGCCATGTA
TAATCTTGGTGTCGCATATGGTGAAATGTTGAATTTTGAGATGGCTATTGTTTTTTACGA
GCTTGCTCTGCACTTCAATCCTCGCTGTGCGGAGGCATGCAACAACCTGGGAGTAATATA
CAAGGACAGGGATAATCTTGACAAAGCTGTTGAATGTTATCAAATGGCCTTGTCAATTAA
GCCAAATTTCTCTCAGTCATTGAATAACCTTGGAGTTGTCTACACTGTCCAGGGAAAGAT
GGATGCTGCTTCAAGCATGATTCAGAAGGCCATATTTGCAAATTCCACGTATGCTGAAGC
ATATAATAACTTGGGTGTTCTTTACAGAGATGCAGGAAGTATTACTTCAGCCGTACAAGC
TTATGAGAAATGCCTTCAAATTGATCCTGATTCACGAAATGCTGGTCAGAATCGTTTGCT
TGCGTTGAATTATATTGATGAGGGCTTTGACGACAAGCTTTATCAAGCTCACAGGGAGTG
GGGAAAACGCTTCCTGAAATTGTATCCACAGTATACTAGTTGGGATAACCCAAAAGTCGC
TGATCGTCCTCTGGTCATTGGCTATGTGTCTCCTGATTACTTTACTCACTCTGTGTCATA
CTTCATTGAAGCTCCCCTTGCACACCATGACTACTCAAATTACAAGGTGGTTGTGTATTC
TGGTGTTGTGAAGGCAGATGCCAAGACCCTTCGATTCAAGGATAAGGTATTAAAAAAGGG
TGGGTTGTGGAGAGATATATATGGTATTGATGAAAAGAAGGTTGCTAGCTTGGTAAGAGA
GGACAAAGTGGATATACTTGTGGAACTTACTGGTCATACGGCAAATAACAAGTTAGGAAC
AATGGCATGCAGGCCTGCTCCTATTCAGGTTACATGGATTGGCTACCCTAATACAACAGG
TCTGCCAACAATTGACTACAGAATAACAGATTCATTGGCTGACCCACCTGATACAACCCA
AAAGCATGTTGAAGAGTTGGTGCGCCTTCCTGAAAGCTTTCTTTGTTACAGTCCTTCCCC
AGAAGCTGGGCCAGTTTGTCCCACTCCAGCAATTTTAAATGGTTTCATCACGTTTGGGAG
TTTTAATAATCTAGCAAAGATTACACCAAAAGTATTGCAAGTTTGGGCCAAAATTTTGTG
TGCAGTCCCTAACTCCCGTCTTGTGGTTAAGTGTAAGCCATTCTGCTGCGACAGTATTAG
ACAGAAATTCCTATCAACACTAGCAGAATTGGGTTTGGAGCCGTTACGAGTTGACTTGCT
GCCACTCATCCATCTCAACCATGATCACATGCAAGCATATTCCCTAATGGACATAAGCCT
GGATACGTTTCCATATGCTGGAACTACTACTACATGTGAATCTCTATACATGGGGGTTCC
ATGTGTTACTATGGCTGGCTCAGTCCATGCTCATAATGTTGGTGTTAGTCTACTCACTAA
AGTTGGGCTGGGGAGGCTGGTTGCGAAGTCTGAGAATGAATATGTTAGCTTAGCATTGGA
TTTAGCGGCAGATGTTACTGCCTTGCAAGAACTGAGAATGAGCCTCCGAGGGCTGATGGC
GAAATCACCAGTGTGTGATGGAGAGAATTTCACACGTGGTCTGGAATCTGCATACAGAAA
CATGTGGCGCAGATACTGTGATGGGGATGCACCTGCCCTCAGGCGGTTGGATCTGTTACA
GGAAGAGCCATGCTCCAATAACAATAAGCAAGATTTTGATGACAATCAGGTCGCAAAGCT
CGCAGATCTGAAAGCACAGAGAGTGGATGCCGCGGTAGATGGAGACAAGCAATCCCAGTT
AACAGCGCATGCTGCAGTAGTAGGGGAAGTTCAGCAGGCCCCAATAATGGTGAATGGTGT
GAGTTCACCTGTCTCTTCTGGGAAAGTTGAAGCAAATGGGCACATAAGCCGGTGACCAAG
GGGAGTCGAGCATACTCCATTGATGTGGGAAACACTGACCCACTGTAGCTTGAGATGCAC
CATTGCTGTGGTGGACATTTGTTCTTACAGAATTCGACGCTTTGCAGGCCTACACTGGGT
GTCTCATTTGTCTGACACCCACAATGGATAAGAAAGAAGAGCACTTCTGTGCCATCCGAC
GGTGATTTCTCTGGTTACACTTTGACCTTTGTAGCAAATGTAAGATTGATGGGGGATATG
CTTATAGAGTTTGATTTGTAGAGGTATACCCCCTGTGTAGGTTTATGAACATGATGGCTT
CAGTTGCCATATGTTAGAAGAAACAGAGAAAGAGGAGGAAGCCCTTGTTGTAAATGCAGA
AAAAACAGAACTGAAAAACTACTAGAATCAATTGACGGCGGCATTTCAACAGGCTGTGTC
ATGATG

CDS

2784 bp

>Os08t0559300-01 O-linked N-acetylglucosamine transferase, Negative regulator of gibberellin (GA) signaling, Brassinosteroid (BR) synthesis
ATGGGGCGACCGGGGATGGACTCCAGCGAAGGGAGGGAGAGCAATGGCGTTGTTCCTGAA
CGTAATGGTGGTGCTGTCCCTGCAAAACAGCAGTTGGACGGGAAGGACACCTTGCGGTAC
GCCAACATCCTCCGCTCCCGCAACAAATTTGCCGAAGCACTCCAGTTGTACAATAATGTC
CTTGAGAAGGATGAAGCCAATGTGGAGGCCCTTATTGGCAAAGGGATTTGCCTCCAGGCA
CAGAGCCTACCTATGCAGGCCATCGAGTGCTTCAACGAGGCCGTCAGGATCGACCCAGGG
AATGCATGTGCTCTCACTTATTGTGGGATGATATACAAAGATGAGGGTCACTTAGTTGAA
GCTGCAGAGGCTTATCAAAAAGCTCGAAATGCAGATCCTTCCTACAAACCTGCTGCAGAG
TTTCTTGCTATTGTGTTGACCGATCTTGGAACTAGCTTGAAGCTTGCAGGTAATACAGAG
GAGGGGATTCAAAAATATTGTGAAGCTTTGGAAGTTGACAGCCACTATGCGCCTGCTTAT
TACAACCTTGGTGTGGTTTACTCGGAGATGATGCAATTTGATTTGGCTCTTACTTGTTAC
GAGAAAGCTGCTTTGGAGAGGCCATTGTATGCTGAAGCTTATTGCAACATGGGAGTTATT
TACAAGAATCGTGGAGAATTAGAAGCAGCAATTGCCTGCTACGAGAGGTGCTTGACTATT
TCCCCAAATTTTGAGATTGCCAAGAATAACATGGCAATAGCACTAACCGACTTGGGTACA
AAGGTAAAAATTGAGGGTGACATTAATCAAGGTGTGGCATATTACAAGAAAGCTCTGTTC
TACAATTGGCACTACGCTGATGCCATGTATAATCTTGGTGTCGCATATGGTGAAATGTTG
AATTTTGAGATGGCTATTGTTTTTTACGAGCTTGCTCTGCACTTCAATCCTCGCTGTGCG
GAGGCATGCAACAACCTGGGAGTAATATACAAGGACAGGGATAATCTTGACAAAGCTGTT
GAATGTTATCAAATGGCCTTGTCAATTAAGCCAAATTTCTCTCAGTCATTGAATAACCTT
GGAGTTGTCTACACTGTCCAGGGAAAGATGGATGCTGCTTCAAGCATGATTCAGAAGGCC
ATATTTGCAAATTCCACGTATGCTGAAGCATATAATAACTTGGGTGTTCTTTACAGAGAT
GCAGGAAGTATTACTTCAGCCGTACAAGCTTATGAGAAATGCCTTCAAATTGATCCTGAT
TCACGAAATGCTGGTCAGAATCGTTTGCTTGCGTTGAATTATATTGATGAGGGCTTTGAC
GACAAGCTTTATCAAGCTCACAGGGAGTGGGGAAAACGCTTCCTGAAATTGTATCCACAG
TATACTAGTTGGGATAACCCAAAAGTCGCTGATCGTCCTCTGGTCATTGGCTATGTGTCT
CCTGATTACTTTACTCACTCTGTGTCATACTTCATTGAAGCTCCCCTTGCACACCATGAC
TACTCAAATTACAAGGTGGTTGTGTATTCTGGTGTTGTGAAGGCAGATGCCAAGACCCTT
CGATTCAAGGATAAGGTATTAAAAAAGGGTGGGTTGTGGAGAGATATATATGGTATTGAT
GAAAAGAAGGTTGCTAGCTTGGTAAGAGAGGACAAAGTGGATATACTTGTGGAACTTACT
GGTCATACGGCAAATAACAAGTTAGGAACAATGGCATGCAGGCCTGCTCCTATTCAGGTT
ACATGGATTGGCTACCCTAATACAACAGGTCTGCCAACAATTGACTACAGAATAACAGAT
TCATTGGCTGACCCACCTGATACAACCCAAAAGCATGTTGAAGAGTTGGTGCGCCTTCCT
GAAAGCTTTCTTTGTTACAGTCCTTCCCCAGAAGCTGGGCCAGTTTGTCCCACTCCAGCA
ATTTTAAATGGTTTCATCACGTTTGGGAGTTTTAATAATCTAGCAAAGATTACACCAAAA
GTATTGCAAGTTTGGGCCAAAATTTTGTGTGCAGTCCCTAACTCCCGTCTTGTGGTTAAG
TGTAAGCCATTCTGCTGCGACAGTATTAGACAGAAATTCCTATCAACACTAGCAGAATTG
GGTTTGGAGCCGTTACGAGTTGACTTGCTGCCACTCATCCATCTCAACCATGATCACATG
CAAGCATATTCCCTAATGGACATAAGCCTGGATACGTTTCCATATGCTGGAACTACTACT
ACATGTGAATCTCTATACATGGGGGTTCCATGTGTTACTATGGCTGGCTCAGTCCATGCT
CATAATGTTGGTGTTAGTCTACTCACTAAAGTTGGGCTGGGGAGGCTGGTTGCGAAGTCT
GAGAATGAATATGTTAGCTTAGCATTGGATTTAGCGGCAGATGTTACTGCCTTGCAAGAA
CTGAGAATGAGCCTCCGAGGGCTGATGGCGAAATCACCAGTGTGTGATGGAGAGAATTTC
ACACGTGGTCTGGAATCTGCATACAGAAACATGTGGCGCAGATACTGTGATGGGGATGCA
CCTGCCCTCAGGCGGTTGGATCTGTTACAGGAAGAGCCATGCTCCAATAACAATAAGCAA
GATTTTGATGACAATCAGGTCGCAAAGCTCGCAGATCTGAAAGCACAGAGAGTGGATGCC
GCGGTAGATGGAGACAAGCAATCCCAGTTAACAGCGCATGCTGCAGTAGTAGGGGAAGTT
CAGCAGGCCCCAATAATGGTGAATGGTGTGAGTTCACCTGTCTCTTCTGGGAAAGTTGAA
GCAAATGGGCACATAAGCCGGTGA

Protein

928 aa

>Os08t0559300-01 O-linked N-acetylglucosamine transferase, Negative regulator of gibberellin (GA) signaling, Brassinosteroid (BR) synthesis
MGRPGMDSSEGRESNGVVPERNGGAVPAKQQLDGKDTLRYANILRSRNKFAEALQLYNNV
LEKDEANVEALIGKGICLQAQSLPMQAIECFNEAVRIDPGNACALTYCGMIYKDEGHLVE
AAEAYQKARNADPSYKPAAEFLAIVLTDLGTSLKLAGNTEEGIQKYCEALEVDSHYAPAY
YNLGVVYSEMMQFDLALTCYEKAALERPLYAEAYCNMGVIYKNRGELEAAIACYERCLTI
SPNFEIAKNNMAIALTDLGTKVKIEGDINQGVAYYKKALFYNWHYADAMYNLGVAYGEML
NFEMAIVFYELALHFNPRCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNL
GVVYTVQGKMDAASSMIQKAIFANSTYAEAYNNLGVLYRDAGSITSAVQAYEKCLQIDPD
SRNAGQNRLLALNYIDEGFDDKLYQAHREWGKRFLKLYPQYTSWDNPKVADRPLVIGYVS
PDYFTHSVSYFIEAPLAHHDYSNYKVVVYSGVVKADAKTLRFKDKVLKKGGLWRDIYGID
EKKVASLVREDKVDILVELTGHTANNKLGTMACRPAPIQVTWIGYPNTTGLPTIDYRITD
SLADPPDTTQKHVEELVRLPESFLCYSPSPEAGPVCPTPAILNGFITFGSFNNLAKITPK
VLQVWAKILCAVPNSRLVVKCKPFCCDSIRQKFLSTLAELGLEPLRVDLLPLIHLNHDHM
QAYSLMDISLDTFPYAGTTTTCESLYMGVPCVTMAGSVHAHNVGVSLLTKVGLGRLVAKS
ENEYVSLALDLAADVTALQELRMSLRGLMAKSPVCDGENFTRGLESAYRNMWRRYCDGDA
PALRRLDLLQEEPCSNNNKQDFDDNQVAKLADLKAQRVDAAVDGDKQSQLTAHAAVVGEV
QQAPIMVNGVSSPVSSGKVEANGHISR*

5'UTR

chr08:27991559..27991844 (+ strand) : 286 bp

chr08:27992263..27992307 (+ strand) : 45 bp

CDS

chr08:27992308..27992676 (+ strand) : 369 bp

chr08:27993401..27993562 (+ strand) : 162 bp

chr08:27993657..27993832 (+ strand) : 176 bp

chr08:27993923..27993998 (+ strand) : 76 bp

chr08:27994396..27994524 (+ strand) : 129 bp

chr08:27994605..27994724 (+ strand) : 120 bp

chr08:27994814..27994880 (+ strand) : 67 bp

chr08:27994974..27995057 (+ strand) : 84 bp

chr08:27995258..27995352 (+ strand) : 95 bp

chr08:27995669..27995733 (+ strand) : 65 bp

chr08:27995846..27996044 (+ strand) : 199 bp

chr08:27996668..27996862 (+ strand) : 195 bp

chr08:27997108..27997202 (+ strand) : 95 bp

chr08:27997301..27997436 (+ strand) : 136 bp

chr08:27997507..27997724 (+ strand) : 218 bp

chr08:27997971..27998098 (+ strand) : 128 bp

chr08:27998390..27998859 (+ strand) : 470 bp

3'UTR

chr08:27998860..27999290 (+ strand) : 431 bp

FASTA

>Os08t0559300-01 class=Sequence position=chr08:27991559..27999290 (+ strand)
AAAGAAGGGA AAAAAAATAC GAAAAGCAAA AAGGAATAAA CGGAGGGGGC TAAACACCAA AATTCCCCCT CTCCTTCTCC
TTCCCCTCCT CCCGAAACCC TCGCCGCCGT CGCTGTCGAA ACCCTCGCTG CTGCTGCTGC CGCACGGCGC GGCGGGGTAC
CGGGTCCCCC TCCCTGCGGC GGCGCGGAGG GGTAGGTCTC CCCCCCCTCG CTGCGGCGTG GCGGTGGGGG GTGCGGTGCC
GGCTGCCGCG CCATGATCTT GCGCCGGTGG ACTGCGCCTA TCCAATGTGA GCTCTCCTCC TACTTCCGCC GCGGCATTAG
GGTTCTTGCT TCTTGAGCTG GAAGAGTTCT CTTGCGTTGC GAACGCCTAC TGTTTCCTGC GAATTCTTAG TGCTTGTTCT
TGGATTCTTT CCGGGGGTGT TCTTAATCTG TTGTTTGCAA AAGTTCTTTT TTTCTTTTTT TGGCTAGGGT TTTGAAATTT
GCAATCTTGG TGTTCTTTTC CCTGAGTTTT TACTAAAAAG CTGCGGCTTT TACGCAATTC GGTGGTAGTC CAAAGCCGCG
TCCTTTTTTT CTAGTCTTTA CGCGCATTTG GCTCCAATTT TTCTCCTTTT TTTAGACGCG TTTTCTTCAC GCTAATATTC
GCAACTGAAA TCTTAGACCT AACGAACCAT TCTAAAATTG ATGATCGTTA CATTCTTTCT GCAGAAAAAA AAAAGATAAA
GATAGAACAA GTAGGTTACT TTCCGTACCA TGGGGCGACC GGGGATGGAC TCCAGCGAAG GGAGGGAGAG CAATGGCGTT
GTTCCTGAAC GTAATGGTGG TGCTGTCCCT GCAAAACAGC AGTTGGACGG GAAGGACACC TTGCGGTACG CCAACATCCT
CCGCTCCCGC AACAAATTTG CCGAAGCACT CCAGTTGTAC AATAATGTCC TTGAGAAGGA TGAAGCCAAT GTGGAGGCCC
TTATTGGCAA AGGGATTTGC CTCCAGGCAC AGAGCCTACC TATGCAGGCC ATCGAGTGCT TCAACGAGGC CGTCAGGATC
GACCCAGGGA ATGCATGTGC TCTCACTTAT TGTGGGATGA TATACAAAGA TGAGGGTCAC TTAGTTGAAG CTGCAGAGGT
ATGCGTAAGA TTCTTCATGT GGATTCCCTG TTCTTACTGT TAGCTTATTC GTTATTGTGA AATCTGATAG TTTTTCTTTT
TAGTTTGTTG TCATAAACAC TAGAAGTCTC AAATGTTGTA TATGTGGTTC TCTGAAAGCA AAATACTCAA ATGCTGAAGT
AAGTGCCTCG CACAGTCGCA CTCCCCAAAA TACCAGGCAA TGAGACTTGG GACTTAACTG CCAATTTCTG ACTTCTGAGG
GTACTGCAGA CCTATTTTTA GCACCAAGTT ATATCTTGAG TGGTTTGTGT CCAAGAACTG TAACTAGAAA CCAAAACAAC
TAGTTTGATA AGTTCTTGAT CAAGCATACT ATGCAAGAGA TAAAACTGTC GAGATAATCA CTCAAGAATT TTCCAGCAGA
AGATTTTTTA TTATCTCCAT GACATACTTA TTAGCACCGT AAAATTTTGT GCGTAGCTGG TGGATAGAAT GACATGTGAA
TGAGCTAAGG CTCAGCTAGA GCTGCAAAAA GAGTAATACT TTTGCCCCTT GGAGAATAGT GGTCCCTATT AATTGGCAGG
GTTGTAAAAA TCCTAAGTTC CTAACCAATC TAACATATAA GATCAAAACA GTTGGTCAGT CCAAAAATTC TCTCGGAAAA
GCTTGGAATT TCGACATTGT TTCTGTATTT ATTATGTGAT ATATTTATCC ATAAATGTTC TGATGGAGAG AAATTGTAAC
AGGCTTATCA AAAAGCTCGA AATGCAGATC CTTCCTACAA ACCTGCTGCA GAGTTTCTTG CTATTGTGTT GACCGATCTT
GGAACTAGCT TGAAGCTTGC AGGTAATACA GAGGAGGGGA TTCAAAAATA TTGTGAAGCT TTGGAAGTTG ACAGCCACTA
TGCGGTACCA TCACCAGCTA TAATTTATAT CTAGATCTCT ATTATTTTGT TTTTGTTATC CATTTAAGTT TTTTAATGTG
TTCATCTGAT TAATGTAGCC TGCTTATTAC AACCTTGGTG TGGTTTACTC GGAGATGATG CAATTTGATT TGGCTCTTAC
TTGTTACGAG AAAGCTGCTT TGGAGAGGCC ATTGTATGCT GAAGCTTATT GCAACATGGG AGTTATTTAC AAGAATCGTG
GAGAATTAGA AGCAGCAATT GCCTGCTACG AGAGGTAAGC TTTATTTTTT CTGCTCATAC AAATTATGCT GATTCCCAAA
GTACTGTTGA AAACTAATGT TGACTTATCT TTACTGTATC CCAGGTGCTT GACTATTTCC CCAAATTTTG AGATTGCCAA
GAATAACATG GCAATAGCAC TAACCGACTT GGGTACAAAG GTGTGGTCTT GCTACCTTTT GTTTCAACCA AATCAACACA
TTGCTTCTTG TGGTGTCCTG CATGTCAATC ATAATGGTTG CCATCACTTG CCCATCATAT TAGCAGTCAT GCGTGACAGG
CTTGAACTAA GACTAGTGTT GATTTGAAAA TTGTCTCAAT CATGTGGGTT AATGAGGAAA CATCATGATA ACTCTATGTT
TTTTCGTTGC TTGTCCGCTC ACTTTTTACT CTGAGCATAG CAACTCTGGC AATATAATTA ATTTTGACTA ACCTTAGAAT
GAATCATATG AAATAGACCT TTTTAATTTA TACTTTGGTA TACCTTTAAG AATTGTTAAC TCTGGCATTT GGTGGTGATT
TTTGTATTTT TCTCTTATCA ATTGACATTT TTCACAGGTA AAAATTGAGG GTGACATTAA TCAAGGTGTG GCATATTACA
AGAAAGCTCT GTTCTACAAT TGGCACTACG CTGATGCCAT GTATAATCTT GGTGTCGCAT ATGGTGAAAT GTTGAATTTT
GAGATGGTCA GTCATAAGAA AAAAATCTTT AATATTCTGT ACATAATGTC CTCTCTTTTG CTGACACTCT TTTCTGTTTT
CCAAAGGCTA TTGTTTTTTA CGAGCTTGCT CTGCACTTCA ATCCTCGCTG TGCGGAGGCA TGCAACAACC TGGGAGTAAT
ATACAAGGAC AGGGATAATC TTGACAAAGC TGTTGAATGT TATCAAGTAA GTGGAACTAA TTATGCAGTA TGCAATATCT
GCAGATAGTC ACAAGTATCA CAACAGATTA TTCATTATCT TCTATTCTGT TGTAGATGGC CTTGTCAATT AAGCCAAATT
TCTCTCAGTC ATTGAATAAC CTTGGAGTTG TCTACACTGT CCAGGCATGC TCCTCTGCTA GTCTTGCACA ATTTCTATTG
GGATTGGATG ATTGTATCAT GTTTTAGCTT ATTGAATATG TTGTTCTTCA TATATAGGGA AAGATGGATG CTGCTTCAAG
CATGATTCAG AAGGCCATAT TTGCAAATTC CACGTATGCT GAAGCATATA ATAACTTGGG TAATGTTTAA CCAACCAACA
TCATGAGAGC CTCTTAAATT CTGCCATGTA ATTTGAAACA GCATTTTCCA GCTGAGACTC ATAACAACTA TATAAGCACT
AATCAGTAAT TCATTTCATT GCTTTGCATA ATTCTCTTTT TGATAGCTGG AATGAGACTT TAATACGTAA CTGACAATCC
ATCACTGCTT TCACCATAGG TGTTCTTTAC AGAGATGCAG GAAGTATTAC TTCAGCCGTA CAAGCTTATG AGAAATGCCT
TCAAATTGAT CCTGATTCAC GAAATGCTGG TCAGGTACTT TCTTTGTCCT AAGCTTGCTA ATTAAAACTT GTGTAATCTT
TCTGTGTTGC ATGGAGAATT AAATTTATTT AAGCAGGTAC AGCTAATAAT TATACTTATC CATTTAGTAG CAAACTGGGA
AGCATATAAA TGTTTCTTCC TTGTATAAAT AGACAAATAC TTGTCTATTG CATGTTCATA ATTTGTTCCA ACCTTGATGT
TGCTTGCCCA CGGTATCTGT TTTGCTGCTT TTTAAAAAAA AATATATATT TGTGGAATAG CTATGGTTTA TATTTGTAAC
ATTCAACTTA CGATATAGCT TGTTCTGCAG AATCGTTTGC TTGCGTTGAA TTATATTGAT GAGGGCTTTG ACGACAAGCT
TTATCAAGCT CACAGGTCAT TTAGCACTTT TTCACAATAT ACAGTCATAT TTATGTTAGA TTGTTTTTTC TGTTTTTATG
TGTTAGAAAT TCTCAACTAT ATATTCACTG TATTTTATAT TTTGCAGGGA GTGGGGAAAA CGCTTCCTGA AATTGTATCC
ACAGTATACT AGTTGGGATA ACCCAAAAGT CGCTGATCGT CCTCTGGTCA TTGGCTATGT GTCTCCTGAT TACTTTACTC
ACTCTGTGTC ATACTTCATT GAAGCTCCCC TTGCACACCA TGACTACTCA AATTACAAGG TGGTTGTGTA TTCTGGTGTT
GTGAAGGTAG ATATAGCCGT TCCTTTTCTT GTCTCTATTT TCCTGCATTT TCACATTGTG TCCCAAAAAA CTTGTTTAGA
CTGTCTTGCC TCATTAAGAT TTAAAATATA TATGGAAATA ATTTATGCAA AAATATTCCT TTTGAAAACA GAAATGGTAG
TTCAATGGTC AATAGGATAG TGAACTGTAA TTATTTTTCA AGATAGGCCT CTAGACTATG TCCAGTTTCA GGATTACCAC
TTTATTATTG CCTAGActga aatgttttaa atagtgggct aagacattta gtggttagcc ttctcaaaca gctatagcta
tagcggctaa attgtacata agagcaaata tttagctaga cccttctcaa acagctatag ccggAGATTT AAAATGCATA
TCCTGAAACC CCCCAAGAAA GATTATCCCA GTAACAGCGA ATATATAATT GGAAATCATC CAAGGTGGCT GACAACTCGG
GGCCATTTAT TTGTGACATA TCAGTTATTT TCCAACTTGC ATGTTTCACT ACTTGTACAA AGAAATTAGG CCCAATTTAT
CTGCAATGTG TTCGAGTACC TGTTTTAATC ACAGTTCATT CATGTTTTCT TCAATTGAAA ATTATTTAGG CAGATGCCAA
GACCCTTCGA TTCAAGGATA AGGTATTAAA AAAGGGTGGG TTGTGGAGAG ATATATATGG TATTGATGAA AAGAAGGTTG
CTAGCTTGGT AAGAGAGGAC AAAGTGGATA TACTTGTGGA ACTTACTGGT CATACGGCAA ATAACAAGTT AGGAACAATG
GCATGCAGGC CTGCTCCTAT TCAGGTACCT TTGTGCCCAT GATTCATAAC TGTCACGTTA CCTAATTTCA GAACTATTTG
GACAGAAGTG ATATCATCAG ATCATTATGT TCTGAAACCA GCTTCTTCTG ATCTTGCTAA CATGATTGCT TCCTTTTCAC
TCTAGTCAAT GAAACTATTC AAGTGTCTAA TAATAAATGA TTATCTGACT ATTCTACTAT GTGATTAGTG AACTGACAGG
GGCTTCTTTT ACTTGAATTG CCTGCACAGG TTACATGGAT TGGCTACCCT AATACAACAG GTCTGCCAAC AATTGACTAC
AGAATAACAG ATTCATTGGC TGACCCACCT GATACAACCC AAAAGTAAGA CATCTGCTTT TCTTGCGGTG ATAGCTTTCT
GGCATGCACT TTTATACCCA CACATCTAGA ACGTGACGGT GACAATTATG AATTATCTGC AGGCATGTTG AAGAGTTGGT
GCGCCTTCCT GAAAGCTTTC TTTGTTACAG TCCTTCCCCA GAAGCTGGGC CAGTTTGTCC CACTCCAGCA ATTTTAAATG
GTTTCATCAC GTTTGGGAGT TTTAATAATC TAGCAAAGGT GACACATAAA ACTTGAGTAA TCAGTTCATT TTTACTGGAT
CACTATTTAT TGATTTTTCT TTTGGCAGAT TACACCAAAA GTATTGCAAG TTTGGGCCAA AATTTTGTGT GCAGTCCCTA
ACTCCCGTCT TGTGGTTAAG TGTAAGCCAT TCTGCTGCGA CAGTATTAGA CAGAAATTCC TATCAACACT AGCAGAATTG
GGTTTGGAGC CGTTACGAGT TGACTTGCTG CCACTCATCC ATCTCAACCA TGATCACATG CAAGCATATT CCCTAATGGA
CATAAGGTCA GTTATTTAGA tacttcctcc gtttcatatt ataagacttt ctagcattgt ccacattcat atagatgttg
tgtctagatt tattaacatc tatgtgaatg tggacaatgc tagaaagtct tataatatga aacggaggga gtaCATCTTT
TATCCTATGT TTAAACATGT TATGTAAACG AGTAGATCCA TTCTACTGCA TTGTATCTTA AATTGTCTGA ACTTTGGTTG
GTTCCTTTGC AGCCTGGATA CGTTTCCATA TGCTGGAACT ACTACTACAT GTGAATCTCT ATACATGGGG GTTCCATGTG
TTACTATGGC TGGCTCAGTC CATGCTCATA ATGTTGGTGT TAGTCTACTC ACTAAAGTTG GTACGTGTCT ATTTACTCTG
TGGTGTATGT AGCAATAGAT CGAATTGCTG TACAGTTTTA TTTTCATGCT ATTTGTTGAT CGACTTGTTT TCTTCTTTTG
CATCGCCATG TGAAGACTCG GAAAAAAAAT CACTATTGTG CTGTCTGGTT TTGAGTTTTG ATACATATAA CTTGATGATT
GGAGCAGGAA TTCTAGCTAT TGAATCTGAC CTTTCTTTAC ACAGTTGAAT CAGGTCGGGT ATATGTTCTC CTTGCCGAAT
TGTTGGTTGA CATTTACTGT TATTCTTGCA GGGCTGGGGA GGCTGGTTGC GAAGTCTGAG AATGAATATG TTAGCTTAGC
ATTGGATTTA GCGGCAGATG TTACTGCCTT GCAAGAACTG AGAATGAGCC TCCGAGGGCT GATGGCGAAA TCACCAGTGT
GTGATGGAGA GAATTTCACA CGTGGTCTGG AATCTGCATA CAGAAACATG TGGCGCAGAT ACTGTGATGG GGATGCACCT
GCCCTCAGGC GGTTGGATCT GTTACAGGAA GAGCCATGCT CCAATAACAA TAAGCAAGAT TTTGATGACA ATCAGGTCGC
AAAGCTCGCA GATCTGAAAG CACAGAGAGT GGATGCCGCG GTAGATGGAG ACAAGCAATC CCAGTTAACA GCGCATGCTG
CAGTAGTAGG GGAAGTTCAG CAGGCCCCAA TAATGGTGAA TGGTGTGAGT TCACCTGTCT CTTCTGGGAA AGTTGAAGCA
AATGGGCACA TAAGCCGGTG ACCAAGGGGA GTCGAGCATA CTCCATTGAT GTGGGAAACA CTGACCCACT GTAGCTTGAG
ATGCACCATT GCTGTGGTGG ACATTTGTTC TTACAGAATT CGACGCTTTG CAGGCCTACA CTGGGTGTCT CATTTGTCTG
ACACCCACAA TGGATAAGAA AGAAGAGCAC TTCTGTGCCA TCCGACGGTG ATTTCTCTGG TTACACTTTG ACCTTTGTAG
CAAATGTAAG ATTGATGGGG GATATGCTTA TAGAGTTTGA TTTGTAGAGG TATACCCCCT GTGTAGGTTT ATGAACATGA
TGGCTTCAGT TGCCATATGT TAGAAGAAAC AGAGAAAGAG GAGGAAGCCC TTGTTGTAAA TGCAGAAAAA ACAGAACTGA
AAAACTACTA GAATCAATTG ACGGCGGCAT TTCAACAGGC TGTGTCATGA TG

Locus: Os08g0559300

Loading...

Locus: Os08g0559300

Loading...