Os08t0559400-01

Locus

Os08g0559400

Description

Homologue of human peptidyl-prolyl isomerase-like 1 (PPiL1), Cyclophilin, Tolerance to drought stress

RAP-DB Gene Symbol Synonym(s)

OsCYP18-2

RAP-DB Gene Name Synonym(s)

Cyclophilin 18-2

CGSNL Gene Symbol

CYP18-2

CGSNL Gene Name

CYCLOPHILIN 18-2

Oryzabase Gene Symbol Synonym(s)

OsCYP18-2, OsCYP-23, OsCYP18-2a, OsCYP18-2b, OsCYP18-2c, SIP12

Oryzabase Gene Name Synonym(s)

cyclophilin 18-2, cyclophilin 23, SKIP interacting protein 12, SKIPa-interacting protein 12, SKIPa-interacting protein 12

Transcript Evidence

AK072675

Protein Evidence

Q93VG0

Literature

PMID: 25847193

Note

Manual Curation

May 14, 2020

Gene Ontology (GO)

Biological Process: protein peptidyl-prolyl isomerization (GO:0000413)

Biological Process: protein folding (GO:0006457)

Molecular Function: peptidyl-prolyl cis-trans isomerase activity (GO:0003755)

Functional domain (InterPro)

Cyclophilin-like domain superfamily (IPR029000)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase (IPR024936)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain (IPR002130)

Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved site (IPR020892)

Experimentally confirmed subcellular location

cytosol (GO:0005829)

nucleus (GO:0005634)

Full-length cDNA

J023135C15 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0559400-01)

RiceXPro (AK072675)

Others

Oryzabase (10055)

KEGG (Os08t0559400-01 (EC:5.2.1.8))

Transcript

799 bp

>Os08t0559400-01 Homologue of human peptidyl-prolyl isomerase-like 1 (PPiL1), Cyclophilin, Tolerance to drought stress
AAGGGAATCTCTCCTCTTCTCTTCTCTTCTCGCGCCGCCGCCGTGTCCAGTGCCCAAGAT
GTGGGGCAGCGCCGACGGCGGCACGCCGGAGGTCACCCTGGAGACATCCATGGGCGCCTT
CACCATCGAGATGTACTACAAGCACGCGCCCAAGACCTGCAGGAACTTCCTCGAGCTCTC
GCGCCGCGGCTACTACGACAACGTCATCTTCCATCGCATCATCAAGGATTTCATCGTGCA
AGGTGGGGATCCTACTGGCACCGGAAGAGGCGGCGAATCCATCTACGGAGCAAAGTTCGA
GGATGAGATTAGGCCAGAACTGAAGCACACCGGCGCTGGAATTCTGTCGATGGCCAACGC
TGGTCCAAATACAAATGGAAGCCAGTTCTTTATTACTCTTGCGCCTTGTCAGTCACTTGA
TGGAAAGCATACAATTTTTGGGAGAGTATCAAAAGGAATGGAAATTGTCAAGCGCCTTGG
AAGTGTCCAGACAGACAAAAGTGATAGGCCCATCCATGAAGTGAAAATCCTGCGGACTGT
GGTCAAAGATTGAGGCACAGCGGGTCTACTCGGTGTCACTCATGACTTCTGGTATTTGGA
GTTGTAGCTGCTGTCAGTTTCAGGAATTGTTTCCTGCTTGTTCCGTGCTTATGCAGTGGT
GTATCGTTTCGGATGGGCTAGTTTAGTTATTAACAACTCATGAATCGTGATCCGTCTTAA
TTATTCTCACCTGAACGAGTAGTGTTCAGTGATTATCAGTGGAAATAACTTTCGAAATAT
ATGAAGTCATTTTGAGCGC

CDS

495 bp

>Os08t0559400-01 Homologue of human peptidyl-prolyl isomerase-like 1 (PPiL1), Cyclophilin, Tolerance to drought stress
ATGTGGGGCAGCGCCGACGGCGGCACGCCGGAGGTCACCCTGGAGACATCCATGGGCGCC
TTCACCATCGAGATGTACTACAAGCACGCGCCCAAGACCTGCAGGAACTTCCTCGAGCTC
TCGCGCCGCGGCTACTACGACAACGTCATCTTCCATCGCATCATCAAGGATTTCATCGTG
CAAGGTGGGGATCCTACTGGCACCGGAAGAGGCGGCGAATCCATCTACGGAGCAAAGTTC
GAGGATGAGATTAGGCCAGAACTGAAGCACACCGGCGCTGGAATTCTGTCGATGGCCAAC
GCTGGTCCAAATACAAATGGAAGCCAGTTCTTTATTACTCTTGCGCCTTGTCAGTCACTT
GATGGAAAGCATACAATTTTTGGGAGAGTATCAAAAGGAATGGAAATTGTCAAGCGCCTT
GGAAGTGTCCAGACAGACAAAAGTGATAGGCCCATCCATGAAGTGAAAATCCTGCGGACT
GTGGTCAAAGATTGA

Protein

165 aa

>Os08t0559400-01 Homologue of human peptidyl-prolyl isomerase-like 1 (PPiL1), Cyclophilin, Tolerance to drought stress
MWGSADGGTPEVTLETSMGAFTIEMYYKHAPKTCRNFLELSRRGYYDNVIFHRIIKDFIV
QGGDPTGTGRGGESIYGAKFEDEIRPELKHTGAGILSMANAGPNTNGSQFFITLAPCQSL
DGKHTIFGRVSKGMEIVKRLGSVQTDKSDRPIHEVKILRTVVKD*

5'UTR

chr08:28002266..28002323 (- strand) : 58 bp

CDS

chr08:28002194..28002265 (- strand) : 72 bp

chr08:28001978..28002073 (- strand) : 96 bp

chr08:28001821..28001882 (- strand) : 62 bp

chr08:28001349..28001482 (- strand) : 134 bp

chr08:28000673..28000757 (- strand) : 85 bp

chr08:28000090..28000135 (- strand) : 46 bp

3'UTR

chr08:27999844..28000089 (- strand) : 246 bp

FASTA

>Os08t0559400-01 class=Sequence position=chr08:27999844..28002323 (- strand)
AAGGGAATCT CTCCTCTTCT CTTCTCTTCT CGCGCCGCCG CCGTGTCCAG TGCCCAAGAT GTGGGGCAGC GCCGACGGCG
GCACGCCGGA GGTCACCCTG GAGACATCCA TGGGCGCCTT CACCATCGAG GTACCATTGG CTCGGCTCGG CTCGGCCGTC
TCTCTCTTGA GCTATTCTTT TCGTCGGCAT ACACCGAGTT AAGTTCTTGC TCCTTGATTT GATTTGGTCG CTTCTCTCGT
CGATCGACAG ATGTACTACA AGCACGCGCC CAAGACCTGC AGGAACTTCC TCGAGCTCTC GCGCCGCGGC TACTACGACA
ACGTCATCTT CCATCGCATC ATCAAGGTTT CTGCCCACTC CTTGCTTGCT GCTTTGCTTA ATAGGAGTAT TAATCAATCC
GGTCAGGTTT TCTTTACTGC TTTTATCTTC TTGCGGTTTA GGATTTCATC GTGCAAGGTG GGGATCCTAC TGGCACCGGA
AGAGGCGGCG AATCCATCTA CGGGTCAGCA TATTTCTTGC TTTCCTCCTC TTTCAATTTG TAAGATTGCA TTGCAACTGT
AACACTCGAT TTTGAACTGT ATTTTGAGCT CACATCATCA ACCCATGATG GATAGCACTG TATTTCTACC TGTTAAAAAC
ATAATAGGGA ATTAGTACCT ATTGTGTAGC AGCATTTGGT AGCGATTGTA CCATTGTTGC TGGGCTCCTG TAGCATCTTG
TTTGTAAAAG TAGCTAAATT TATTATTCCT TGTTATTTTC CACGCCACGC CGTTATTGCA TTCTATTTGG GGCTCTGTTT
GAATCCTTAC AAATGTTTGT GTTCTTGCTG TGTTTTTACA GAGCAAAGTT CGAGGATGAG ATTAGGCCAG AACTGAAGCA
CACCGGCGCT GGAATTCTGT CGATGGCCAA CGCTGGTCCA AATACAAATG GAAGCCAGTT CTTTATTACT CTTGCGCCTT
GTCAGTCACT TGATGGTGAG TCTACCGTAC TGTCTCATTG TTGCTCCAGT TTTACATTAT GCTTTCGCTT GTTTGCTGTC
TATGAATGTT CTTTGCATTG CCCTGGAAAG CTGAAGTTCA CTCTGTAGGA GTTAATCAAC AATTTCTCAG ATTGCAACCT
AAAAACTTTA CTATCAAATC ACTGCAAGTT TTTTTTTAAT ATTAGATTTG GAATAATTAC AAGAAAAACT TGGGACTAGC
TTTTGAAGAG CCTGTTGTAG AGTGACTTTG AGTCTAGTGC AATCACTAGG AGCGTGATTC TTGGAGACTT CTGGTGGATT
TCTGGGACTC CTGTTCTTCT GTATTGTGAT GTTGGTACAT TGGACTGCAT TGTTGTTAAT GTGTAATGCA ATTGTGAAGG
ACTTCTGCTA GCACCATCAC TGTTTTTTCT TCCTAATTGC CAACCCTGGA AGATTTTGCC CCTCAGGATG TCACTGCTTA
CATCTGTTTT TGACATTGTA TTTCGCACTC TGGATTGCTT TTACAAATAT GTTCTTTTCG AAATTTCCAC ATTGAAAGTC
AGGTACATTT TCATGCTATT AAGGTTATAT GGTTTTCCTA TTCCAGGAAA GCATACAATT TTTGGGAGAG TATCAAAAGG
AATGGAAATT GTCAAGCGCC TTGGAAGTGT CCAGACAGAC AAAAGTGATA GGTAACACCA AAACTATATG CCATGGTTGT
ACATATCACA TAATAGATAT AGCATCCGAT TTGTCCTGAG GGAGAGTTGA GTGAGTGCAA CGCCTCGCTA TTACCATGCA
TATGCAATGG CAAAGTAGGT AGCAGGGTAG CAGCAGGAGG GAAATATTTG GGATGATGAG TTGCAGCGTT AGTAGATTTG
GCTAGGATCt actcccttcg ttccacatta taagatgttt tggcctctcc attcgttggc tagattcact aacatccata
agcagtttag cacatacatg gatccatgca ttaatctatc caaaactcaa atcgtcttat aattttaact tataatgtga
aacggagaaa gtaTTCATCA TGGTAGAGAA CAATGAGAGC TGCGGGTGAG TGAGGGCGAA TGGTGGGAGG GAGATAACCA
AATCATGTGT ACAATCCATG TATGGTGCCT GTAAAACTGA AAGGGAAAAT GATCGATATG CATTTTTCCT GTCGAATTTA
TTCAGACTTG TTATCTTTGT TGATTCAGGC CCATCCATGA AGTGAAAATC CTGCGGACTG TGGTCAAAGA TTGAGGCACA
GCGGGTCTAC TCGGTGTCAC TCATGACTTC TGGTATTTGG AGTTGTAGCT GCTGTCAGTT TCAGGAATTG TTTCCTGCTT
GTTCCGTGCT TATGCAGTGG TGTATCGTTT CGGATGGGCT AGTTTAGTTA TTAACAACTC ATGAATCGTG ATCCGTCTTA
ATTATTCTCA CCTGAACGAG TAGTGTTCAG TGATTATCAG TGGAAATAAC TTTCGAAATA TATGAAGTCA TTTTGAGCGC

Locus: Os08g0559400

Loading...

Locus: Os08g0559400

Loading...