Os08t0560500-01

Locus

Os08g0560500

Description

Serine carboxypeptidase-like protein, Defense responses against multiple biotic and abiotic stresses

RAP-DB Gene Symbol Synonym(s)

OsBISCPL1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SCP41

CGSNL Gene Name

SERINE CARBOXYPEPTIDASE 41

Oryzabase Gene Symbol Synonym(s)

OsSCP41

Oryzabase Gene Name Synonym(s)

Serine carboxypeptidase 41

Transcript Evidence

AK101389

AK119519

Protein Evidence

Q6YYX5

Literature

PMID: 18571878

Note

Manual Curation

January 25, 2021

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type carboxypeptidase activity (GO:0004185)

Functional domain (InterPro)

Alpha/Beta hydrolase fold (IPR029058)

Peptidase S10, serine carboxypeptidase (IPR001563)

Serine carboxypeptidase, serine active site (IPR018202)

Full-length cDNA

J033036J23 (Online Clone Ordering)

001-202-C12 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0560500-01)

RiceXPro (AK101389)

Others

Oryzabase (19220)

KEGG (Os08t0560500-01 (EC:3.4.16.-))

Transcript

1743 bp

>Os08t0560500-01 Serine carboxypeptidase-like protein, Defense responses against multiple biotic and abiotic stresses
ATTTCTAGCTAGTTAGTATCTCATCTCCTTTTTGCTGAGGCTGAGGGAGAGGCAGAGGCT
GCCTCACGCATCCCTGTCGATCTCGGTCAAGAATGGGGTTGCTGATGAGGCCCGTCGCCT
TGCTCATCTACTGCACCACCGCCTCCCTCTTCTTCCTCACCTCCTCCTCCTCCGCCGCCA
TCGCCGGTGGCACGCCGGACGGCTCGGAGGAGTGGGGCTATGTCCAAGTACGCCCGAAGG
CGCACATGTTCTGGTGGTTGTACCGGAGCCCGCAGCGCGTGAACAACAAGGGCAGCACGC
CATGGCCGACCGTGCTCTGGCTCCAGGGAGGCCCGGGCGCTTCGGGCGTGGGTTATGGCA
ACTTCATGGAGATCGGGCCGCTGGACACCAACCTTAAACCCCGCCCATCCACCTGGCTCT
CCAAGGCCGACCTCCTCTTCGTCGACAACCCAGTGGGCACCGGGTTCAGCTACGTGGAGG
GCGGCGACAGGACATTGCTGGCGCGCACGGACGCCGAGGCAGCCACCGACCTCACCACTC
TGCTCTCCCAACTCTACCGCAGCAACAACACGCGGCTGCAGGGGAGCCCACTTTACATCG
TCGCAGAGTCCTACGGCGGCAAGTTCGCCGTCACCACCGCCTTGGCCGCGCTCAAGGCCA
TCCACGCCGGCCGCCTCGCCGCCAGCCTCGCCGGAGTTGCGCTTGGTAATAGCTGGATTT
CACCCGAGGACTCGGTGCTTTCGTGGGGGCCATTGCTGTACCAAGTGTCCCGCCTTGACG
AGAACGGCCTCTACCTCTCCGACAGCCTGGCGCAGCAGATCAAGGCGCAGGTGAAGGCAG
CACAGTTCCTGGAGGCCGAGAACACATGGCAAAGTCTGGAGTCCATCATTCTCGAGCAAG
CCAACTTCATCGACTTCTACAATTTCCTCAAGGATGACTCGTCGTCGGATGCTAATTTGG
AGCAGCAGCAGCGGCAGAGGCTACTGGCGTCGCTGGGGCAGTCGAGGAGGCGCTACTCCA
GCTACCTGAGCTCCAAGGTCACAACGGAAGGCGGCTTCGAGGGCATCATGAACACCGTCA
TCAGGGATAAGCTCCGGATCATACCCAAAAACGTCACCTGGAGCGAGCAGTCAGACGATG
TGTTCGAAGCTCTTGCAGGAGACTTCATGAAACCCAGAATCCTTGAGGTCGACGAGCTTC
TCAACCTTGGCCTCAACGTCACAATCTATAGCGGACAGCTTGATCTGATCTGTGCGACCA
AGGGAACATTGGATTGGATTCAGAAACTCAAGTGGGATGGTCTGAAGAACTTCACAAACT
CACGCAGAGTGCCGCTCTACTGCAGTGGTGGTGAAGCAGCTGGCACCCAAGCCTTCCTCA
AATCTTACAAGAATCTCAAATTCTACTGGATACTGGGAGCTGGCCACATGGTACCAATAG
ACAACCCTTGCCCTGCATTGAAGATGCTTGGTGACATTACACAATCTCCTGCTCAGTAGA
AAAGAGGAGGATGACACTACATGCTGACACCAACTGAAGATTCTTTTTCTCCTTAATTTC
TACTTTCACCTTTTTACACAGAAAAGAAAAAGGATATCATAGCATTGATGAGATAAGAAA
AGATAGCAGAGTGATATAAATAGAGAGAGAGAGATCTGTTTCACTTTATATTATAGTACT
GGTGCAGCTGGTTTTTCGGTGACAGGGTACAATATAAAATCAAATTTATTGCATGCAGCT
TGC

CDS

1407 bp

>Os08t0560500-01 Serine carboxypeptidase-like protein, Defense responses against multiple biotic and abiotic stresses
ATGGGGTTGCTGATGAGGCCCGTCGCCTTGCTCATCTACTGCACCACCGCCTCCCTCTTC
TTCCTCACCTCCTCCTCCTCCGCCGCCATCGCCGGTGGCACGCCGGACGGCTCGGAGGAG
TGGGGCTATGTCCAAGTACGCCCGAAGGCGCACATGTTCTGGTGGTTGTACCGGAGCCCG
CAGCGCGTGAACAACAAGGGCAGCACGCCATGGCCGACCGTGCTCTGGCTCCAGGGAGGC
CCGGGCGCTTCGGGCGTGGGTTATGGCAACTTCATGGAGATCGGGCCGCTGGACACCAAC
CTTAAACCCCGCCCATCCACCTGGCTCTCCAAGGCCGACCTCCTCTTCGTCGACAACCCA
GTGGGCACCGGGTTCAGCTACGTGGAGGGCGGCGACAGGACATTGCTGGCGCGCACGGAC
GCCGAGGCAGCCACCGACCTCACCACTCTGCTCTCCCAACTCTACCGCAGCAACAACACG
CGGCTGCAGGGGAGCCCACTTTACATCGTCGCAGAGTCCTACGGCGGCAAGTTCGCCGTC
ACCACCGCCTTGGCCGCGCTCAAGGCCATCCACGCCGGCCGCCTCGCCGCCAGCCTCGCC
GGAGTTGCGCTTGGTAATAGCTGGATTTCACCCGAGGACTCGGTGCTTTCGTGGGGGCCA
TTGCTGTACCAAGTGTCCCGCCTTGACGAGAACGGCCTCTACCTCTCCGACAGCCTGGCG
CAGCAGATCAAGGCGCAGGTGAAGGCAGCACAGTTCCTGGAGGCCGAGAACACATGGCAA
AGTCTGGAGTCCATCATTCTCGAGCAAGCCAACTTCATCGACTTCTACAATTTCCTCAAG
GATGACTCGTCGTCGGATGCTAATTTGGAGCAGCAGCAGCGGCAGAGGCTACTGGCGTCG
CTGGGGCAGTCGAGGAGGCGCTACTCCAGCTACCTGAGCTCCAAGGTCACAACGGAAGGC
GGCTTCGAGGGCATCATGAACACCGTCATCAGGGATAAGCTCCGGATCATACCCAAAAAC
GTCACCTGGAGCGAGCAGTCAGACGATGTGTTCGAAGCTCTTGCAGGAGACTTCATGAAA
CCCAGAATCCTTGAGGTCGACGAGCTTCTCAACCTTGGCCTCAACGTCACAATCTATAGC
GGACAGCTTGATCTGATCTGTGCGACCAAGGGAACATTGGATTGGATTCAGAAACTCAAG
TGGGATGGTCTGAAGAACTTCACAAACTCACGCAGAGTGCCGCTCTACTGCAGTGGTGGT
GAAGCAGCTGGCACCCAAGCCTTCCTCAAATCTTACAAGAATCTCAAATTCTACTGGATA
CTGGGAGCTGGCCACATGGTACCAATAGACAACCCTTGCCCTGCATTGAAGATGCTTGGT
GACATTACACAATCTCCTGCTCAGTAG

Protein

469 aa

>Os08t0560500-01 Serine carboxypeptidase-like protein, Defense responses against multiple biotic and abiotic stresses
MGLLMRPVALLIYCTTASLFFLTSSSSAAIAGGTPDGSEEWGYVQVRPKAHMFWWLYRSP
QRVNNKGSTPWPTVLWLQGGPGASGVGYGNFMEIGPLDTNLKPRPSTWLSKADLLFVDNP
VGTGFSYVEGGDRTLLARTDAEAATDLTTLLSQLYRSNNTRLQGSPLYIVAESYGGKFAV
TTALAALKAIHAGRLAASLAGVALGNSWISPEDSVLSWGPLLYQVSRLDENGLYLSDSLA
QQIKAQVKAAQFLEAENTWQSLESIILEQANFIDFYNFLKDDSSSDANLEQQQRQRLLAS
LGQSRRRYSSYLSSKVTTEGGFEGIMNTVIRDKLRIIPKNVTWSEQSDDVFEALAGDFMK
PRILEVDELLNLGLNVTIYSGQLDLICATKGTLDWIQKLKWDGLKNFTNSRRVPLYCSGG
EAAGTQAFLKSYKNLKFYWILGAGHMVPIDNPCPALKMLGDITQSPAQ*

5'UTR

chr08:28069300..28069391 (+ strand) : 92 bp

CDS

chr08:28069392..28069536 (+ strand) : 145 bp

chr08:28069690..28069787 (+ strand) : 98 bp

chr08:28070085..28070192 (+ strand) : 108 bp

chr08:28070337..28070586 (+ strand) : 250 bp

chr08:28070727..28070770 (+ strand) : 44 bp

chr08:28071423..28071490 (+ strand) : 68 bp

chr08:28071929..28072034 (+ strand) : 106 bp

chr08:28072119..28072324 (+ strand) : 206 bp

chr08:28072563..28072683 (+ strand) : 121 bp

chr08:28073544..28073596 (+ strand) : 53 bp

chr08:28073719..28073857 (+ strand) : 139 bp

chr08:28074298..28074366 (+ strand) : 69 bp

3'UTR

chr08:28074367..28074610 (+ strand) : 244 bp

FASTA

>Os08t0560500-01 class=Sequence position=chr08:28069300..28074610 (+ strand)
ATTTCTAGCT AGTTAGTATC TCATCTCCTT TTTGCTGAGG CTGAGGGAGA GGCAGAGGCT GCCTCACGCA TCCCTGTCGA
TCTCGGTCAA GAATGGGGTT GCTGATGAGG CCCGTCGCCT TGCTCATCTA CTGCACCACC GCCTCCCTCT TCTTCCTCAC
CTCCTCCTCC TCCGCCGCCA TCGCCGGTGG CACGCCGGAC GGCTCGGAGG AGTGGGGCTA TGTCCAAGTA CGCCCGAGTA
AGCATCTTCA ACTCTTCTTC TTCTTCCTCC TCCTCCTTTT ACTTTGATGA TATTGTGTAT ACTAGCTTAT TATTGGGTAT
ATATTATATT GATCCATCGA TCGAAATAAT ATGATTATGA TGTTGGTCCG TATATACTAT GTACGTGCAG AGGCGCACAT
GTTCTGGTGG TTGTACCGGA GCCCGCAGCG CGTGAACAAC AAGGGCAGCA CGCCATGGCC GACCGTGCTC TGGCTCCAGG
GAGGCCCGGT AATCAAttca ttaattaaat cgtacatata tatatatata tatagtcatc atccagatga ttatatatat
ataTTGATTG CAGGCAGCTA GCTGGTTCCG ATATCGATCG ACCACCCATA TATGCATAAT TGATTAATTT ACTGATTGCA
TAATTATTTA TATATAGTAT ATGAAATATA ATTAATCATC CAGCTAGCTA ATTAATCAAC AACCATTGCT CCCTCCAATG
TTATCGTAGT AGTACGTACG TAGTATCATG CATCTTGTGT AGTTAACAAA CAAGCGATAT TGCAGGGCGC TTCGGGCGTG
GGTTATGGCA ACTTCATGGA GATCGGGCCG CTGGACACCA ACCTTAAACC CCGCCCATCC ACCTGGCTCT CCAAGGCCGA
CCTCCTCTTC GTCGTAATAC TATGATTTTG CTTAATTTCG ATCTCATTAT CTTAAACAAA TTTTCTGGAG AGAGAGAGAT
AGAGATAGAG ATAGAGATAG AGTAGTTGTA GGTTGGTGAA GGATGAATTG AATGGTGCAA TGAGATGGCA ATGGCAGGAC
AACCCAGTGG GCACCGGGTT CAGCTACGTG GAGGGCGGCG ACAGGACATT GCTGGCGCGC ACGGACGCCG AGGCAGCCAC
CGACCTCACC ACTCTGCTCT CCCAACTCTA CCGCAGCAAC AACACGCGGC TGCAGGGGAG CCCACTTTAC ATCGTCGCAG
AGTCCTACGG CGGCAAGTTC GCCGTCACCA CCGCCTTGGC CGCGCTCAAG GCCATCCACG CCGGCCGCCT CGCCGCCAGC
CTCGCCGGTA CTTACACCCA TATATCCACC ATTGCCCCAT TTGCATCTAT CTCTACCCAT ATACACAGTA ATCTCTTTAT
TATATACCTA CACCAAATGA ATGTGTATAT ATGTAAACAA TGACTTAATC TTCATGTCTT TATGCAGGAG TTGCGCTTGG
TAATAGCTGG ATTTCACCCG AGGACTCGGT GGTAAGTACT AGCTCAATAC TCCCATCACA CTAGTTAATA AATTTAGaac
gtatcatgtt tacacgagtc ttctcgtgta caccccgtat atatcttgca caccaattaa caaatttcaa aaaaaaagaa
aaagataaaa tttccaacag cattacactt atgtgtaaag ttttaacctc aaattcactg cattttgaga gtaaaaacaa
agataaaatt tcttacaatt ttaagggtat aaattgatca caattttatc ctttttttgt gcttcttatg tagattgaat
ttcaagatgg aactttacac ataaatgtgt tactacctaa agtatatgta caaacgtttt tttagaattt ttggtgaagt
ttgttagttg gtatatatat tgtgtacatg aaaaatattg tggatatgat atgctcTCAA Ttactccatc agtctaaaaa
tataagagat tttgaatggg tggaatattt tctactacta taaatttgga cagagagttt atctagattt gtagtagtat
gaagtgttct atccgtttaa aatcttttat attttagaac ggaaggagta ATTAGTAAGA GGAAAAGAAG ATATTTTGGG
ATTTGATGGA AATAAACGGT CGGGTGCCTA TATTTGTTGG CAGCTTTCGT GGGGGCCATT GCTGTACCAA GTGTCCCGCC
TTGACGAGAA CGGCCTCTAC CTCTCCGACA GGTTAACTTA CTACTACACT ACTTTTcgtt tcaaattatt agtcgtttta
attttagtta aagtcaactg cttcaaattt aattaagttt atagataaaa taataatact tttaatccaa gacaaataaa
ttatgaaaga atatttaatt atcgatttaa tgaaactgat ttggttttgt aaatattata gtatatttgt ttacaaactt
agttaaactt gaagcaattt gactttgaca aaagttaaaa cgtcttataa tctgaaacag aaggagtGCT ACTTTTTATT
TTCATATCAG TTGCATGCAA TGGTTGGCTA GTTAGTTGCT TGCAATTCAT CCGTCCCAAT TCAGTCTTTT TTTAATTACT
TATTGTTTAC AAAAATGGAT ATTAAGGCGA CGTATAAATT AAACAAGGCA AATGCAAATG CAAATGCAGC CTGGCGCAGC
AGATCAAGGC GCAGGTGAAG GCAGCACAGT TCCTGGAGGC CGAGAACACA TGGCAAAGTC TGGAGTCCAT CATTCTCGAG
CAAGCCAACT TCATCGTGCG TCTCACTAAT ATTTATACTT ATATACATAT ATGCACAGAG TTTGTATTAG TTTGTGAAAG
AGAAATGTGA TGGGTGCAGG ACTTCTACAA TTTCCTCAAG GATGACTCGT CGTCGGATGC TAATTTGGAG CAGCAGCAGC
GGCAGAGGCT ACTGGCGTCG CTGGGGCAGT CGAGGAGGCG CTACTCCAGC TACCTGAGCT CCAAGGTCAC AACGGAAGGC
GGCTTCGAGG GCATCATGAA CACCGTCATC AGGGATAAGC TCCGGATCAT ACCCAAAAAC GTCACGTACG TATACCAACA
TTATTTTACA ACTTACATAT ATATGTATAA TGCACAATGC ATGCACATAC AAATGATATA GTATTTCCTA TGTTTCAATT
TATCCCAATT TATTATACTA GATGTATCAA ATCTCATCTT AGGTAGTAAC ATTTCTGGGA CGAAGGAAGT ATATGGGATC
TCTGAATTTA ATTGTTGTCC CATCTAACTT TAATTATATA CTGTCCACGA TCGAAATATA TAGCTGGAGC GAGCAGTCAG
ACGATGTGTT CGAAGCTCTT GCAGGAGACT TCATGAAACC CAGAATCCTT GAGGTCGACG AGCTTCTCAA CCTTGGCCTC
AACGTCACAA TCTATAGCGG ACAGGTATCA AACTCAACTC TCCTCTCTGC TACTCCTACA TTTATGTATG GGTCTTTCAA
CATGTGGATT TATCGCTTTG TCTGATCCAT CGACCAATTA CTTGATGTAT GTCAGCATGT TCTACCTAGC TTACACCCAA
ACATTACACA TCATGAGTCC TGGCTGTTGC TTTGCATGCA TGGCACTGGC ACAGTATCAT GCTTCAGTTG TCCGTCAGGA
AATGTGTTAT CACCTGTTGT TTTGTTTGTC CGTCCCCGTA TTGCCTAGTG TCATATTAAT CCATACTCAT ACAAGGTACT
AGCTCTACAG TACATGCTCT TTGATCGCCA GCAAGAATAT ATTCCACATG ACAGACAGCA GTGCATGTTG CACACCTGCT
GGTATCATCA GCATCTCTAG TCCATCTATC GGATTCGTGC AATCTCATCA GACACACATA CATATCTTCA TCAGGCTACC
CTAGGTGCAT ATGTATATGT GATGTGATAT CCTTAGGCTT ATCACGGGCA TATATCTGGA CGAATATATG TGTATGTCAG
CTCCATGCTT TCTTCTTGTA CTCCTAACTT TTGTTTCTTG CACCAACACA CAAAGGCCAC CAGGAATATA TAGTTGATTT
AGCTTCATCT ATTGGGAAAG GCACAACCTA CATCGTAACA GACACATGAC CCCTAACATG TGTGACTGTC CATTTTGTCT
CAACTTCTGA ACCATATTCT GGATATATAT ATATATATAT AGAGTTACTA AATGCCAAAT GCATCGCAGC AACCAACTAT
ATATATAAAT AAATAAATAA TATATCTGAA GATAGCCAAA GTTTAGCTTT CTTATAGTTA ATTAATTGGC AATTGTTCAT
TCAGCTTGAT CTGATCTGTG CGACCAAGGG AACATTGGAT TGGATTCAGA AACTCAAGTA AGCATTTGCA GTTTCTGCAC
AAACCCCCCC TCTCTTATTA CTGCAGAATT AATGCATGAG AAGCAAATTA CAAAGACAAG TGGTTTAATG GCCCATGCAT
GCCTGTTGTT TGATGTCAGG TGGGATGGTC TGAAGAACTT CACAAACTCA CGCAGAGTGC CGCTCTACTG CAGTGGTGGT
GAAGCAGCTG GCACCCAAGC CTTCCTCAAA TCTTACAAGA ATCTCAAATT CTACTGGATA CTGGGAGCTG GCCACATGGT
AAGTAGTAGT AACCTCTAGC TAGTATTCCA ACACATATAC TAGTATATTA GAGTAAAACA ATGGTATTGT TGGAACCTGT
GGTGTCAGCT ACCCTGATTG CATGCAAGTG CAATTATTTT TGTGCAAGCA TAGCCATCAG GATTTGGACA GGCTAGATTC
AGTGTGAGCT GGAAAGAGTG TGCATTCATG TAGTACTAGT AGCTGGTGAG AGAGTTTCTT CAAGGATCAA TAGCAGCACA
TGCAGAAGCA AGCAATACAG TGCCTTTGAG AAAGACAAGA GGCCGGCAGG GACACATGCA CCAACAGTGA TAGATAGATA
GGGAGAGGAG GAGGGATCAG GGATGGAGGG AGCTTACTAG GACAGGCAGG TGAACTTGTG TAGTGGCTTC TTCAATGTTT
GTCGATGCTG AAATCTATTT TCCTTCTCTT GCTGACAGGT ACCAATAGAC AACCCTTGCC CTGCATTGAA GATGCTTGGT
GACATTACAC AATCTCCTGC TCAGTAGAAA AGAGGAGGAT GACACTACAT GCTGACACCA ACTGAAGATT CTTTTTCTCC
TTAATTTCTA CTTTCACCTT TTTACACAGA AAAGAAAAAG GATATCATAG CATTGATGAG ATAAGAAAAG ATAGCAGAGT
GATATAAATA GAGAGAGAGA GATCTGTTTC ACTTTATATT ATAGTACTGG TGCAGCTGGT TTTTCGGTGA CAGGGTACAA
TATAAAATCA AATTTATTGC ATGCAGCTTG C

Locus: Os08g0560500

Loading...

Locus: Os08g0560500

Loading...