Os08t0562200-03

Locus

Os08g0562200

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC40

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 40

Oryzabase Gene Symbol Synonym(s)

ONAC040, ONAC40, ONAC054, ONAC54, OsNTL5, NTL5

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 040, NAC domain-containing protein 40, NAC domain-containing protein 54, NAC membrane-bound transcription factor 5, NAC MTF5, membrane-bound NAC-like TF 5

Transcript Evidence

AK069733 (DDBJ, Best hit)

Protein Evidence

D9HQD9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J023030H12 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0562200-03)

RiceXPro (AK069733)

Others

Oryzabase (11480)

KEGG (Os08t0562200-03)

Transcript

1997 bp

>Os08t0562200-03 Hypothetical conserved gene.
GCTGCGTTTCGTTTCTTCCCCAAAAACCAAGGGGGAAGGCAAACTTTCCCCAAATCTCAA
CCCCAATCCCAATCTAGGGCACATGAGCCACCCCTCGTCGTCGTCCTCCTCCGCTCCCCC
GGCGGCGGCCGAGGCCACCTCCCTCGCAccgggattccggttccacccgacggatgagga
gctggtgtcctactacctgaagcggaaggtccatgggcggccgctcaaggtggacgccat
cgcggaggtggacctgtacaaggtggagccatgggacctcccCGCCCGCTCCCGCCTCCG
CAGCCGCGACTCCCagtggtacttcttcagccgcctcgaccgcaagcacgccaaccgcgc
ccgcaccaaccgcgccaccgccggcggctactggaagaccaccggcaaggacagggaggt
ccgcaacggccccaccaccgtcggcatgaagaagaccctcgtcttccacgccggccgcgc
ccccaagggcgagcgcaccaactgggtcatgcacgagtaccgcctcgacggccaaaccac
catcccACCACAGGATTCATTCGTCGTGTGCCGTATCTTCCAGAAAGCCGGCCCAGGTCC
ACAGAACGGGGCTCAGTACGGAGCTCCTTTTGTTGAGGAGGAGTGGGAGGAGGATGACGA
GGATGTTGGTTTGCTACCGGTGGAGGAGAAGGACAACTCTGATGACCAGGAAAAGGAAAT
TTCTGGTGCTATGGAGAAGGGCTATCTCCAGATGAGTGACCTCGTTCAGAACTTGGTTGA
TCAAAATGAGAATGGTACCATTGCCTTGCCAGTTTCTGACAATTCAAACAACAGCAACCA
TTCTGAAGACGTGGATGGAAATTCAGGGGACATTTTAAGTGACCAAAACCTTGGGTCTAA
CTTTCTTCACCATGTTGAGCCTGTGGAGCAAAATGGCCTAGTGCTTAATGAAAATATGTT
TTCTAGTGCCAATGCTGGAGACCTTTTTAATATATCTAGCCCCAATGATGGATTCCTAGA
ACTGAAGGATTTTGCAGATATTGCAGATTTGGAGAATCCTTTAGCCAATGAATCCACCAT
CTGGCCTTCTGATGGTTGGCCCTGGAAATCAACTGATTCCATGGAGGCTGTGAATGGGGC
TAGCAATGAATTTTCTCCCTTAGCTGGTGAACAGATATTCCAGCCAGAAGAATTGGAACA
GTTGTTACAGTCACTGCAAGAAGACTCTCATATGGGTTCAACTATCTCTGATCCCCCACA
TTCATCTATAACAAATTTAGCTAAGCCAGAGGAAGATTGTCTAATGTTCTATGATGCACC
CTTTGATTCTTCAATGTGTGATGATGGTTTTAGACAGCTCAATGGATTTCTTGGCTCCCC
ATCGACCAATCTATCTGGTATTGACATGGTGGACGATGGTATGCCGTACTATGATGCGAT
GGATGATAACTTGTTTAATGATCTTCTGAGCTCAGTACAGCCATCAGCTGGTAGCAGTTC
CCATGCTTTTAGTGGGCCAGTCCTTACTCAAGAGGTCAACAATTCAACCTATACATATAG
TCCAACTCAAAAGGTTTTAGAACCTAATTTTGTAGTTGGTGCCCCATCATCTGCTAGGTT
ACCTGAAGCGGGTAGTCAGTTAAATTATGTTGTTTTACCAGGTAATATTACTATGGAGAA
GTACCATAGGTCAATTATTATTTCCTGCTCTTTAGTGCTGATCCATCATGGAAAAAGAGC
ATTCTCAGCACTTTTTGGGCCACTAATAATTAATCTTTTTTTTTTTGCAATGAGGAATTG
TTCATTGTTGTATTTACTTGTCCTGATTGAGCAAGATTTAAGTATTACTAGATCATTTTT
GTGGAGACACTCTTATCTTGCTCAATCAGTGCAGTGTTACACACAATTGGCATGTGATTT
CTCATTGCCTGGCCATTAACTTGTACCTGTAATTGAACATTATTGACAAGTGTTTGTACT
ATATTCCACAGATTCCC

CDS

1857 bp

>Os08t0562200-03 Hypothetical conserved gene.
ATGAGCCACCCCTCGTCGTCGTCCTCCTCCGCTCCCCCGGCGGCGGCCGAGGCCACCTCC
CTCGCAccgggattccggttccacccgacggatgaggagctggtgtcctactacctgaag
cggaaggtccatgggcggccgctcaaggtggacgccatcgcggaggtggacctgtacaag
gtggagccatgggacctcccCGCCCGCTCCCGCCTCCGCAGCCGCGACTCCCagtggtac
ttcttcagccgcctcgaccgcaagcacgccaaccgcgcccgcaccaaccgcgccaccgcc
ggcggctactggaagaccaccggcaaggacagggaggtccgcaacggccccaccaccgtc
ggcatgaagaagaccctcgtcttccacgccggccgcgcccccaagggcgagcgcaccaac
tgggtcatgcacgagtaccgcctcgacggccaaaccaccatcccACCACAGGATTCATTC
GTCGTGTGCCGTATCTTCCAGAAAGCCGGCCCAGGTCCACAGAACGGGGCTCAGTACGGA
GCTCCTTTTGTTGAGGAGGAGTGGGAGGAGGATGACGAGGATGTTGGTTTGCTACCGGTG
GAGGAGAAGGACAACTCTGATGACCAGGAAAAGGAAATTTCTGGTGCTATGGAGAAGGGC
TATCTCCAGATGAGTGACCTCGTTCAGAACTTGGTTGATCAAAATGAGAATGGTACCATT
GCCTTGCCAGTTTCTGACAATTCAAACAACAGCAACCATTCTGAAGACGTGGATGGAAAT
TCAGGGGACATTTTAAGTGACCAAAACCTTGGGTCTAACTTTCTTCACCATGTTGAGCCT
GTGGAGCAAAATGGCCTAGTGCTTAATGAAAATATGTTTTCTAGTGCCAATGCTGGAGAC
CTTTTTAATATATCTAGCCCCAATGATGGATTCCTAGAACTGAAGGATTTTGCAGATATT
GCAGATTTGGAGAATCCTTTAGCCAATGAATCCACCATCTGGCCTTCTGATGGTTGGCCC
TGGAAATCAACTGATTCCATGGAGGCTGTGAATGGGGCTAGCAATGAATTTTCTCCCTTA
GCTGGTGAACAGATATTCCAGCCAGAAGAATTGGAACAGTTGTTACAGTCACTGCAAGAA
GACTCTCATATGGGTTCAACTATCTCTGATCCCCCACATTCATCTATAACAAATTTAGCT
AAGCCAGAGGAAGATTGTCTAATGTTCTATGATGCACCCTTTGATTCTTCAATGTGTGAT
GATGGTTTTAGACAGCTCAATGGATTTCTTGGCTCCCCATCGACCAATCTATCTGGTATT
GACATGGTGGACGATGGTATGCCGTACTATGATGCGATGGATGATAACTTGTTTAATGAT
CTTCTGAGCTCAGTACAGCCATCAGCTGGTAGCAGTTCCCATGCTTTTAGTGGGCCAGTC
CTTACTCAAGAGGTCAACAATTCAACCTATACATATAGTCCAACTCAAAAGGTTTTAGAA
CCTAATTTTGTAGTTGGTGCCCCATCATCTGCTAGGTTACCTGAAGCGGGTAGTCAGTTA
AATTATGTTGTTTTACCAGGTAATATTACTATGGAGAAGTACCATAGGTCAATTATTATT
TCCTGCTCTTTAGTGCTGATCCATCATGGAAAAAGAGCATTCTCAGCACTTTTTGGGCCA
CTAATAATTAATCTTTTTTTTTTTGCAATGAGGAATTGTTCATTGTTGTATTTACTTGTC
CTGATTGAGCAAGATTTAAGTATTACTAGATCATTTTTGTGGAGACACTCTTATCTTGCT
CAATCAGTGCAGTGTTACACACAATTGGCATGTGATTTCTCATTGCCTGGCCATTAA

Protein

619 aa

>Os08t0562200-03 Hypothetical conserved gene.
MSHPSSSSSSAPPAAAEATSLAPGFRFHPTDEELVSYYLKRKVHGRPLKVDAIAEVDLYK
VEPWDLPARSRLRSRDSQWYFFSRLDRKHANRARTNRATAGGYWKTTGKDREVRNGPTTV
GMKKTLVFHAGRAPKGERTNWVMHEYRLDGQTTIPPQDSFVVCRIFQKAGPGPQNGAQYG
APFVEEEWEEDDEDVGLLPVEEKDNSDDQEKEISGAMEKGYLQMSDLVQNLVDQNENGTI
ALPVSDNSNNSNHSEDVDGNSGDILSDQNLGSNFLHHVEPVEQNGLVLNENMFSSANAGD
LFNISSPNDGFLELKDFADIADLENPLANESTIWPSDGWPWKSTDSMEAVNGASNEFSPL
AGEQIFQPEELEQLLQSLQEDSHMGSTISDPPHSSITNLAKPEEDCLMFYDAPFDSSMCD
DGFRQLNGFLGSPSTNLSGIDMVDDGMPYYDAMDDNLFNDLLSSVQPSAGSSSHAFSGPV
LTQEVNNSTYTYSPTQKVLEPNFVVGAPSSARLPEAGSQLNYVVLPGNITMEKYHRSIII
SCSLVLIHHGKRAFSALFGPLIINLFFFAMRNCSLLYLLVLIEQDLSITRSFLWRHSYLA
QSVQCYTQLACDFSLPGH*

5'UTR

chr08:28149146..28149227 (- strand) : 82 bp

CDS

chr08:28148675..28149145 (- strand) : 471 bp

chr08:28147956..28148171 (- strand) : 216 bp

chr08:28146392..28147156 (- strand) : 765 bp

chr08:28145892..28146296 (- strand) : 405 bp

3'UTR

chr08:28145834..28145891 (- strand) : 58 bp

FASTA

>Os08t0562200-03 class=Sequence position=chr08:28145834..28149227 (- strand)
GCTGCGTTTC GTTTCTTCCC CAAAAACCAA GGGGGAAGGC AAACTTTCCC CAAATCTCAA CCCCAATCCC AATCTAGGGC
ACATGAGCCA CCCCTCGTCG TCGTCCTCCT CCGCTCCCCC GGCGGCGGCC GAGGCCACCT CCCTCGCAcc gggattccgg
ttccacccga cggatgagga gctggtgtcc tactacctga agcggaaggt ccatgggcgg ccgctcaagg tggacgccat
cgcggaggtg gacctgtaca aggtggagcc atgggacctc ccCGCCCGCT CCCGCCTCCG CAGCCGCGAC TCCCagtggt
acttcttcag ccgcctcgac cgcaagcacg ccaaccgcgc ccgcaccaac cgcgccaccg ccggcggcta ctggaagacc
accggcaagg acagggaggt ccgcaacggc cccaccaccg tcggcatgaa gaagaccctc gtcttccacg ccggccgcgc
ccccaagggc gagcgcacca actgggtcat gcacgagtac cgcctcgacg gccaaaccac catcccACCA CAGGTCCCCC
CATCCCTTCC TATCTTACCC TTACCTTACC TGCTCATGTA TCAGATTGAC CCATGTTTCA GATTATATTT CTATTTCTCG
CCATATGTAT CCCTCCATTT CTCTTTCTAT CTTACCCTTA CCTGCCCATC TATGATTGAT TGATTGATAA CCCATGTTTC
AGATTACAGT TTTCTTTCTC GCACTATGTA TATTAACGAA TTGGTGCTCG AGTTATTAAA TCCATGATTT TGCTAGCTAT
GGTCTCTCTT AGATATTTTT TTTTTAAAAA AATATGTTTC CCCCTACACT GTTTCGGGGA AACAAAACAA AGTGTTTGAT
AACTCACTGA ACTGCTAGTC ACTGATTTGC CCGTCCCCAA CAGCGCTCCT GCCTGATTGC TAGATTACTA CTAGTACGTA
GGCATGTTTA CTGCCGCTAC GGCCTCAATT TGTTGATTAT TCTGCTGCTG ATAATGCGAT GCCATGATGC TGATTTTGAG
ACCTATATGT GTACAGGATT CATTCGTCGT GTGCCGTATC TTCCAGAAAG CCGGCCCAGG TCCACAGAAC GGGGCTCAGT
ACGGAGCTCC TTTTGTTGAG GAGGAGTGGG AGGAGGATGA CGAGGATGTT GGTTTGCTAC CGGTGGAGGA GAAGGACAAC
TCTGATGACC AGGAAAAGGA AATTTCTGGT GCTATGGAGA AGGGCTATCT CCAGATGAGT GACCTCGTTC AGGTACAGTT
TCAAATCGCA CGCTTTCTGT TTTCTCACCG TTCTAGTACA AATCTAGCAC CTTTTAACAT CAGATGCTGA AATGCATACC
AATCAATTTC AGGACTGCTT CTATATGTGT AGTTTATTCC AGTCATTCTT CCATATCAAT ACTTGACATT TTTCCTACCA
AACTGTCAAA TAGTAATTGT TGATGGCGCC TTTTGTACGA TTAAGTTATT TTTTTTATTG AACATGGCCT TTTGTGGTAT
GTTGTGTTTA TGATCGTATA CATTGATTAA CCATCTATCT CTCTCAGAAA AGGAACGCTG GATTTTCTTC AGCATTGCCC
TTTAGACAAC CTGTAATGAT GAATTTGTAT GCCGTGCTAT GTACTGTGGA TGCTGACATG TATTCACTTT TGATGTACAT
CTTCATATCT CTCAGGACTA GGTAGCAAGT AATATGAGAT CACGACCCAC AAGAGTCATG ATATCATAGT ATCCATGTCT
ATGAGCATTA AAAGGTTGGA TTTTTTGTGC TGCCTATCTA TGTCTTCATT GTATATTACC AACTTCTGAG ACCCCTAAAA
CATATATTGT TATAACTTGT TCAACAAATT GGTCTTGGTA AAATGAACCT ATTTTCTCTA GTAAAAGAGG AGCGTATTGT
TCGTCCACAC AAGACTTCCT TTTTTGTATG AGTTTTGTTC TGCAGGTGAT TTTTGTTTTT TCATGTCTCA GTTTATCAGT
TTCTTTATCC AGTATATATC TGCCTCTGTG TCGATTGTTC TAATATGCTG TCATTTCCTT TTTTTTTTCA GAACTTGGTT
GATCAAAATG AGAATGGTAC CATTGCCTTG CCAGTTTCTG ACAATTCAAA CAACAGCAAC CATTCTGAAG ACGTGGATGG
AAATTCAGGG GACATTTTAA GTGACCAAAA CCTTGGGTCT AACTTTCTTC ACCATGTTGA GCCTGTGGAG CAAAATGGCC
TAGTGCTTAA TGAAAATATG TTTTCTAGTG CCAATGCTGG AGACCTTTTT AATATATCTA GCCCCAATGA TGGATTCCTA
GAACTGAAGG ATTTTGCAGA TATTGCAGAT TTGGAGAATC CTTTAGCCAA TGAATCCACC ATCTGGCCTT CTGATGGTTG
GCCCTGGAAA TCAACTGATT CCATGGAGGC TGTGAATGGG GCTAGCAATG AATTTTCTCC CTTAGCTGGT GAACAGATAT
TCCAGCCAGA AGAATTGGAA CAGTTGTTAC AGTCACTGCA AGAAGACTCT CATATGGGTT CAACTATCTC TGATCCCCCA
CATTCATCTA TAACAAATTT AGCTAAGCCA GAGGAAGATT GTCTAATGTT CTATGATGCA CCCTTTGATT CTTCAATGTG
TGATGATGGT TTTAGACAGC TCAATGGATT TCTTGGCTCC CCATCGACCA ATCTATCTGG TATTGACATG GTGGACGATG
GTATGCCGTA CTATGATGCG ATGGATGATA ACTTGTTTAA TGATCTTCTG AGCTCAGTAC AGCCATCAGC TGGTAGCAGT
TCCCATGCTT TTAGTGGGCC AGTCCTTACT CAAGAGGTAC AGTCATTTGC ATCAAGCGAT GAACTTGTTG CATTTTGTGC
ACGCCATTGA TGTGTTTACT GGAAATCACC CATAATTTTC TACTTTTACA GGTCAACAAT TCAACCTATA CATATAGTCC
AACTCAAAAG GTTTTAGAAC CTAATTTTGT AGTTGGTGCC CCATCATCTG CTAGGTTACC TGAAGCGGGT AGTCAGTTAA
ATTATGTTGT TTTACCAGGT AATATTACTA TGGAGAAGTA CCATAGGTCA ATTATTATTT CCTGCTCTTT AGTGCTGATC
CATCATGGAA AAAGAGCATT CTCAGCACTT TTTGGGCCAC TAATAATTAA TCTTTTTTTT TTTGCAATGA GGAATTGTTC
ATTGTTGTAT TTACTTGTCC TGATTGAGCA AGATTTAAGT ATTACTAGAT CATTTTTGTG GAGACACTCT TATCTTGCTC
AATCAGTGCA GTGTTACACA CAATTGGCAT GTGATTTCTC ATTGCCTGGC CATTAACTTG TACCTGTAAT TGAACATTAT
TGACAAGTGT TTGTACTATA TTCCACAGAT TCCC

Locus: Os08g0562200

Loading...

Locus: Os08g0562200

Loading...