Os08t0562500-01

Locus

Os08g0562500

Description

BAHD acyltransferase-like protein, Control of grain size and leaf angle, Regulation of brassinosteroid homeostasis

RAP-DB Gene Symbol Synonym(s)

SLG

RAP-DB Gene Name Synonym(s)

SLENDER GRAIN, slender grain

CGSNL Gene Symbol

SLG

CGSNL Gene Name

SLENDER GRAIN

Oryzabase Gene Symbol Synonym(s)

OsSLG

Oryzabase Gene Name Synonym(s)

slender grain

Transcript Evidence

AK109443

Protein Evidence

Q6YYV8

Literature

PMID: 27252468

Note

Manual Curation

June 21, 2017

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Experimentally confirmed subcellular location

cytoplasm, nucleus

Full-length cDNA

006-312-A03 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0562500-01)

RiceXPro (AK109443)

Others

Oryzabase (22380)

KEGG (Os08t0562500-01 (EC:2.3.1.-))

Transcript

1649 bp

>Os08t0562500-01 BAHD acyltransferase-like protein, Control of grain size and leaf angle, Regulation of brassinosteroid homeostasis
ACTCGCTCACACTCTGATCAGCTCTCTAATCACATATATATCGTATCGATCAACGACGAC
GACAATGGCGGCCGTCGACAATGCCCCGCCGTCGCCAGTGGTCACCGTCACCTCCACCCG
CACcgtcgccccagccgccgccaagtgcgtcctcgccacattcgacctcccctacatcac
cttctactacaaccagaagctgctcctctaccgcctccccaacggcgcctccgacttccc
cgacgccgtcgcccgcatgtccgcctccctctccgacgccctcgcctacttctacccgct
cgccggccgcatccgccaggacgaccacgacggctccctctccatccacggccaacacgg
cgccgaggtcatcgaggcCTCCGCCGACCATGTCTCCGTCGACCAACTCGCCGGAGAGGA
GTGCTCGGAGGAGGCGGAGAAGGTGATGCAGCTCCTCGTCCCCTACACCGGCGTCATGAA
CCTCGAGGGCCTGAACCGCCCGCTGCTCGCCGTCCAGTTGACACGTCTGCGGGACGGGGT
GGCAGTGGGGTGCGCCttcaaccacgccgtcctcgacggcacctccacctggcacttcat
gacgtcatgggcggagctctgccggggcggcggcgcgccgtCGCTGCTGCCGGTGCACAA
CCGCGGCATGGCGCGCTCCGTCCGCGTCAACCTCCCGCTCCCGGCGTCCGCCGAGGCGCA
CGAGAAGACCGACCCCAATGGGCCCAAGGTGCCCCTCGTGGCCCGCGTCTTCTCCTTCCC
GCCCTCCGCCGTGGCCCGCGCCAAGGCCGCCGCCAACGCCGCCCTGCCCCCCGGCGCCAA
GCCCTTCTCCTCCTTCCAGTCGCTCGCCGCCCACATCTGGCGCGCCGTCTCCCGCGCCCG
CGCCCTCGGCCCCTCCGACATCACCGTCTTCGCCGTCTTCGCCGACTGCCGCGCCCGCCT
CAGCCCGCCCCTCCCGCCCGCCTACTTCGGCAACCTCATCCAGGCCGTCTTCACCGGCGT
GCCCGCGGGGATGCTCCTCGCTGGCCCGCCCGAGCTCGCCGCGGGGCTGCTGCAGAAGGC
CATCGACGACCACGACGCCGCCGCCATCACCCGGAGGCTGGAGGAGTACGAGGCGGCGCC
CAAGCTGTTCCACTACAGCGACGCCGGCCCCAACTGCGTCGCCGTCGGCAGCTCGCCGCG
CTTCAGGGTGTACGACGTCGACTTCGGCTTCGGCCGCCCGGAGCGGGTGCGAAGCGGCGC
CAACAACAAGTTCGACGGGATGGTCTACCTCTACCCGGGCCGCGGCGGCGACGGCGGCAT
CGACGTCGAGCTCTCGCTGCAGCCGGAGCCGATGCAGAGGTTGGACAAGGACCAAGACTT
CCTCCAAATGCGAGCCCCTTAATTCTTTTTTTTTTCTTTTATACTCCTATATATTATGAT
GATTCATCAGCTGCATGTTACTCCCTAGTAGTCTTGTTCCTCCTAAATTGCAACTTCTCC
TACTACTCCTTTATGTTTAGTTGGATGCATGCATGGATTCCTTGTTGCTTGCTACTATTT
ATATATAGTGGAGTACTATGTTGTGTACTATGTTGCTTGCAAGCTACATTTATATGTGGA
TTTGCATATATTGAATTGGTCCATTACTT

CDS

1338 bp

>Os08t0562500-01 BAHD acyltransferase-like protein, Control of grain size and leaf angle, Regulation of brassinosteroid homeostasis
ATGGCGGCCGTCGACAATGCCCCGCCGTCGCCAGTGGTCACCGTCACCTCCACCCGCACc
gtcgccccagccgccgccaagtgcgtcctcgccacattcgacctcccctacatcaccttc
tactacaaccagaagctgctcctctaccgcctccccaacggcgcctccgacttccccgac
gccgtcgcccgcatgtccgcctccctctccgacgccctcgcctacttctacccgctcgcc
ggccgcatccgccaggacgaccacgacggctccctctccatccacggccaacacggcgcc
gaggtcatcgaggcCTCCGCCGACCATGTCTCCGTCGACCAACTCGCCGGAGAGGAGTGC
TCGGAGGAGGCGGAGAAGGTGATGCAGCTCCTCGTCCCCTACACCGGCGTCATGAACCTC
GAGGGCCTGAACCGCCCGCTGCTCGCCGTCCAGTTGACACGTCTGCGGGACGGGGTGGCA
GTGGGGTGCGCCttcaaccacgccgtcctcgacggcacctccacctggcacttcatgacg
tcatgggcggagctctgccggggcggcggcgcgccgtCGCTGCTGCCGGTGCACAACCGC
GGCATGGCGCGCTCCGTCCGCGTCAACCTCCCGCTCCCGGCGTCCGCCGAGGCGCACGAG
AAGACCGACCCCAATGGGCCCAAGGTGCCCCTCGTGGCCCGCGTCTTCTCCTTCCCGCCC
TCCGCCGTGGCCCGCGCCAAGGCCGCCGCCAACGCCGCCCTGCCCCCCGGCGCCAAGCCC
TTCTCCTCCTTCCAGTCGCTCGCCGCCCACATCTGGCGCGCCGTCTCCCGCGCCCGCGCC
CTCGGCCCCTCCGACATCACCGTCTTCGCCGTCTTCGCCGACTGCCGCGCCCGCCTCAGC
CCGCCCCTCCCGCCCGCCTACTTCGGCAACCTCATCCAGGCCGTCTTCACCGGCGTGCCC
GCGGGGATGCTCCTCGCTGGCCCGCCCGAGCTCGCCGCGGGGCTGCTGCAGAAGGCCATC
GACGACCACGACGCCGCCGCCATCACCCGGAGGCTGGAGGAGTACGAGGCGGCGCCCAAG
CTGTTCCACTACAGCGACGCCGGCCCCAACTGCGTCGCCGTCGGCAGCTCGCCGCGCTTC
AGGGTGTACGACGTCGACTTCGGCTTCGGCCGCCCGGAGCGGGTGCGAAGCGGCGCCAAC
AACAAGTTCGACGGGATGGTCTACCTCTACCCGGGCCGCGGCGGCGACGGCGGCATCGAC
GTCGAGCTCTCGCTGCAGCCGGAGCCGATGCAGAGGTTGGACAAGGACCAAGACTTCCTC
CAAATGCGAGCCCCTTAA

Protein

446 aa

>Os08t0562500-01 BAHD acyltransferase-like protein, Control of grain size and leaf angle, Regulation of brassinosteroid homeostasis
MAAVDNAPPSPVVTVTSTRTVAPAAAKCVLATFDLPYITFYYNQKLLLYRLPNGASDFPD
AVARMSASLSDALAYFYPLAGRIRQDDHDGSLSIHGQHGAEVIEASADHVSVDQLAGEEC
SEEAEKVMQLLVPYTGVMNLEGLNRPLLAVQLTRLRDGVAVGCAFNHAVLDGTSTWHFMT
SWAELCRGGGAPSLLPVHNRGMARSVRVNLPLPASAEAHEKTDPNGPKVPLVARVFSFPP
SAVARAKAAANAALPPGAKPFSSFQSLAAHIWRAVSRARALGPSDITVFAVFADCRARLS
PPLPPAYFGNLIQAVFTGVPAGMLLAGPPELAAGLLQKAIDDHDAAAITRRLEEYEAAPK
LFHYSDAGPNCVAVGSSPRFRVYDVDFGFGRPERVRSGANNKFDGMVYLYPGRGGDGGID
VELSLQPEPMQRLDKDQDFLQMRAP*

5'UTR

chr08:28165242..28165305 (- strand) : 64 bp

CDS

chr08:28164789..28165241 (- strand) : 453 bp

chr08:28163383..28164267 (- strand) : 885 bp

3'UTR

chr08:28163136..28163382 (- strand) : 247 bp

FASTA

>Os08t0562500-01 class=Sequence position=chr08:28163136..28165305 (- strand)
ACTCGCTCAC ACTCTGATCA GCTCTCTAAT CACATATATA TCGTATCGAT CAACGACGAC GACAATGGCG GCCGTCGACA
ATGCCCCGCC GTCGCCAGTG GTCACCGTCA CCTCCACCCG CACcgtcgcc ccagccgccg ccaagtgcgt cctcgccaca
ttcgacctcc cctacatcac cttctactac aaccagaagc tgctcctcta ccgcctcccc aacggcgcct ccgacttccc
cgacgccgtc gcccgcatgt ccgcctccct ctccgacgcc ctcgcctact tctacccgct cgccggccgc atccgccagg
acgaccacga cggctccctc tccatccacg gccaacacgg cgccgaggtc atcgaggcCT CCGCCGACCA TGTCTCCGTC
GACCAACTCG CCGGAGAGGA GTGCTCGGAG GAGGCGGAGA AGGTGATGCA GCTCCTCGTC CCCTACACCG GCGTCATGAA
CCTCGAGGGC CTGAACCGCC CGCTGCTCGC CGTCCAGGTA CCTACATTAC TATTTATTAC TAACATTTCT CCAATTTTAA
TTATTTATAT ATCCTTTTGA TATGATGCCT CAACATAATG ATTATTTAGA CATTTTTCTC AGGACTTAAT TAATTCACAC
ATAATTTACT TTAATTTCCT TCTGGAACTA AACTACTTTA ATCTAGTACA GTATGTAAGT ATATGTGTTG TGTATTTTTT
TTAGTCTCTA GGAGACCGTA AACCTGAACG GTATGTATGC ACGTACGTAC TTTTGATGAG TATTAGTTGT ATAGTACATA
GTACACTACT AGCTGTAGCA GTACGTACAT ACGGTGGTAC AATATTGTAT TGATGAGCTG AAAATTGAAG GGTGGCATGG
AATGGAATGG GCCTTACCTG CAGTATCTGT ATGTGCAGGC TGATTAATTA ACCAGCCAAC CACCAACACT GTCCAAATTT
ATTACTATAC GGAGTACTAG TATATATTAC AAACAAATTT AATTAGGTAC TCTGATGGAA TTGACGCGGT GCATGCAGTT
GACACGTCTG CGGGACGGGG TGGCAGTGGG GTGCGCCttc aaccacgccg tcctcgacgg cacctccacc tggcacttca
tgacgtcatg ggcggagctc tgccggggcg gcggcgcgcc gtCGCTGCTG CCGGTGCACA ACCGCGGCAT GGCGCGCTCC
GTCCGCGTCA ACCTCCCGCT CCCGGCGTCC GCCGAGGCGC ACGAGAAGAC CGACCCCAAT GGGCCCAAGG TGCCCCTCGT
GGCCCGCGTC TTCTCCTTCC CGCCCTCCGC CGTGGCCCGC GCCAAGGCCG CCGCCAACGC CGCCCTGCCC CCCGGCGCCA
AGCCCTTCTC CTCCTTCCAG TCGCTCGCCG CCCACATCTG GCGCGCCGTC TCCCGCGCCC GCGCCCTCGG CCCCTCCGAC
ATCACCGTCT TCGCCGTCTT CGCCGACTGC CGCGCCCGCC TCAGCCCGCC CCTCCCGCCC GCCTACTTCG GCAACCTCAT
CCAGGCCGTC TTCACCGGCG TGCCCGCGGG GATGCTCCTC GCTGGCCCGC CCGAGCTCGC CGCGGGGCTG CTGCAGAAGG
CCATCGACGA CCACGACGCC GCCGCCATCA CCCGGAGGCT GGAGGAGTAC GAGGCGGCGC CCAAGCTGTT CCACTACAGC
GACGCCGGCC CCAACTGCGT CGCCGTCGGC AGCTCGCCGC GCTTCAGGGT GTACGACGTC GACTTCGGCT TCGGCCGCCC
GGAGCGGGTG CGAAGCGGCG CCAACAACAA GTTCGACGGG ATGGTCTACC TCTACCCGGG CCGCGGCGGC GACGGCGGCA
TCGACGTCGA GCTCTCGCTG CAGCCGGAGC CGATGCAGAG GTTGGACAAG GACCAAGACT TCCTCCAAAT GCGAGCCCCT
TAATTCTTTT TTTTTTCTTT TATACTCCTA TATATTATGA TGATTCATCA GCTGCATGTT ACTCCCTAGT AGTCTTGTTC
CTCCTAAATT GCAACTTCTC CTACTACTCC TTTATGTTTA GTTGGATGCA TGCATGGATT CCTTGTTGCT TGCTACTATT
TATATATAGT GGAGTACTAT GTTGTGTACT ATGTTGCTTG CAAGCTACAT TTATATGTGG ATTTGCATAT ATTGAATTGG
TCCATTACTT