Os08t0562500-02

Locus

Os08g0562500

Description

Similar to Acyltransferase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SLG

CGSNL Gene Name

SLENDER GRAIN

Oryzabase Gene Symbol Synonym(s)

OsSLG

Oryzabase Gene Name Synonym(s)

slender grain

Transcript Evidence

AK063515 (DDBJ, Best hit)

Protein Evidence

B4F922 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Full-length cDNA

001-116-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0562500-02)

RiceXPro (AK063515)

Others

Oryzabase (22380)

KEGG (Os08t0562500-02)

Transcript

2253 bp

>Os08t0562500-02 Similar to Acyltransferase.
TGCCCCGCCGTCGCCAGTGGTCACCGTCACCTCCACCCGCACcgtcgccccagccgccgc
caagtgcgtcctcgccacattcgacctcccctacatcaccttctactacaaccagaagct
gctcctctaccgcctccccaacggcgcctccgacttccccgacgccgtcgcccgcatgtc
cgcctccctctccgacgccctcgcctacttctacccgctcgccggccgcatccgccagga
cgaccacgacggctccctctccatccacggccaacacggcgccgaggtcatcgaggcCTC
CGCCGACCATGTCTCCGTCGACCAACTCGCCGGAGAGGAGTGCTCGGAGGAGGCGGAGAA
GGTGATGCAGCTCCTCGTCCCCTACACCGGCGTCATGAACCTCGAGGGCCTGAACCGCCC
GCTGCTCGCCGTCCAGGTACCTACATTACTATTTATTACTAACATTTCTCCAATTTTAAT
TATTTATATATCCTTTTGATATGATGCCTCAACATAATGATTATTTAGACATTTTTCTCA
GGACTTAATTAATTCACACATAATTTACTTTAATTTCCTTCTGGAACTAAACTACTTTAA
TCTAGTACAGTATGTAAGTATATGTGTTGTGTATTTTTTTTAGTCTCTAGGAGACCGTAA
ACCTGAACGGTATGTATGCACGTACGTACTTTTGATGAGTATTAGTTGTATAGTACATAG
TACACTACTAGCTGTAGCAGTACGTACATACGGTGGTACAATATTGTATTGATGAGCTGA
AAATTGAAGGGTGGCATGGAATGGAATGGGCCTTACCTGCAGTATCTGTATGTGCAGGCT
GATTAATTAACCAGCCAACCACCAACACTGTCCAAATTTATTACTATACGGAGTACTAGT
ATATATTACAAACAAATTTAATTAGGTACTCTGATGGAATTGACGCGGTGCATGCAGTTG
ACACGTCTGCGGGACGGGGTGGCAGTGGGGTGCGCCttcaaccacgccgtcctcgacggc
acctccacctggcacttcatgacgtcatgggcggagctctgccggggcggcggcgcgccg
tCGCTGCTGCCGGTGCACAACCGCGGCATGGCGCGCTCCGTCCGCGTCAACCTCCCGCTC
CCGGCGTCCGCCGAGGCGCACGAGAAGACCGACCCCAATGGGCCCAAGGTGCCCCTCGTG
GCCCGCGTCTTCTCCTTCCCGCCCTCCGCCGTGGCCCGCGCCAAGGCCGCCGCCAACGCC
GCCCTGCCCCCCGGCGCCAAGCCCTTCTCCTCCTTCCAGTCGCTCGCCGCCCACATCTGG
CGCGCCGTCTCCCGCGCCCGCGCCCTCGGCCCCTCCGACATCACCGTCTTCGCCGTCTTC
GCCGACTGCCGCGCCCGCCTCAGCCCGCCCCTCCCGCCCGCCTACTTCGGCAACCTCATC
CAGGCCGTCTTCACCGGCGTGCCCGCGGGGATGCTCCTCGCTGGCCCGCCCGAGCTCGCC
GCGGGGCTGCTGCAGAAGGCCATCGACGACCACGACGCCGCCGCCATCACCCGGAGGCTG
GAGGAGTACGAGGCGGCGCCCAAGCTGTTCCACTACAGCGACGCCGGCCCCAACTGCGTC
GCCGTCGGCAGCTCGCCGCGCTTCAGGGTGTACGACGTCGACTTCGGCTTCGGCCGCCCG
GAGCGGGTGCGAAGCGGCGCCAACAACAAGTTCGACGGGATGGTCTACCTCTACCCGGGC
CGCGGCGGCGACGGCGGCATCGACGTCGAGCTCTCGCTGCAGCCGGAGCCGATGCAGAGG
TTGGACAAGGACCAAGACTTCCTCCAAATGCGAGCCCCTTAATTCTTTTTTTTTTCTTTT
ATACTCCTATATATTATGATGATTCATCAGCTGCATGTTACTCCCTAGTAGTCTTGTTCC
TCCTAAATTGCAACTTCTCCTACTACTCCTTTATGTTTAGTTGGATGCATGCATGGATTC
CTTGTTGCTTGCTACTATTTATATATAGTGGAGTACTATGTTGTGTACTATGTTGCTTGC
AAGCTACATTTATATGTGGATTTGCATATATTGAATTGGTCCATTACTTAAATAAGGATC
GGATATGGAATTAATTAGCAGCTATACAGTTTGTGTGTACTTAATTATTAAGCCCATGCA
TCATATCTGGCCTGTTGCTTGATTGGAAATGTAACCTATTAATGTATTTGTAATTTTTGT
ACTCCAATGATTACTGGAATTGCTTACATGTTT

CDS

498 bp

>Os08t0562500-02 Similar to Acyltransferase.
GCCCCGCCGTCGCCAGTGGTCACCGTCACCTCCACCCGCACcgtcgccccagccgccgcc
aagtgcgtcctcgccacattcgacctcccctacatcaccttctactacaaccagaagctg
ctcctctaccgcctccccaacggcgcctccgacttccccgacgccgtcgcccgcatgtcc
gcctccctctccgacgccctcgcctacttctacccgctcgccggccgcatccgccaggac
gaccacgacggctccctctccatccacggccaacacggcgccgaggtcatcgaggcCTCC
GCCGACCATGTCTCCGTCGACCAACTCGCCGGAGAGGAGTGCTCGGAGGAGGCGGAGAAG
GTGATGCAGCTCCTCGTCCCCTACACCGGCGTCATGAACCTCGAGGGCCTGAACCGCCCG
CTGCTCGCCGTCCAGGTACCTACATTACTATTTATTACTAACATTTCTCCAATTTTAATT
ATTTATATATCCTTTTGA

Protein

166 aa

>Os08t0562500-02 Similar to Acyltransferase.
APPSPVVTVTSTRTVAPAAAKCVLATFDLPYITFYYNQKLLLYRLPNGASDFPDAVARMS
ASLSDALAYFYPLAGRIRQDDHDGSLSIHGQHGAEVIEASADHVSVDQLAGEECSEEAEK
VMQLLVPYTGVMNLEGLNRPLLAVQVPTLLFITNISPILIIYISF*

5'UTR

chr08:28165224..28165224 (- strand) : 1 bp

CDS

chr08:28164726..28165223 (- strand) : 498 bp

3'UTR

chr08:28162972..28164725 (- strand) : 1754 bp

FASTA

>Os08t0562500-02 class=Sequence position=chr08:28162972..28165224 (- strand)
TGCCCCGCCG TCGCCAGTGG TCACCGTCAC CTCCACCCGC ACcgtcgccc cagccgccgc caagtgcgtc ctcgccacat
tcgacctccc ctacatcacc ttctactaca accagaagct gctcctctac cgcctcccca acggcgcctc cgacttcccc
gacgccgtcg cccgcatgtc cgcctccctc tccgacgccc tcgcctactt ctacccgctc gccggccgca tccgccagga
cgaccacgac ggctccctct ccatccacgg ccaacacggc gccgaggtca tcgaggcCTC CGCCGACCAT GTCTCCGTCG
ACCAACTCGC CGGAGAGGAG TGCTCGGAGG AGGCGGAGAA GGTGATGCAG CTCCTCGTCC CCTACACCGG CGTCATGAAC
CTCGAGGGCC TGAACCGCCC GCTGCTCGCC GTCCAGGTAC CTACATTACT ATTTATTACT AACATTTCTC CAATTTTAAT
TATTTATATA TCCTTTTGAT ATGATGCCTC AACATAATGA TTATTTAGAC ATTTTTCTCA GGACTTAATT AATTCACACA
TAATTTACTT TAATTTCCTT CTGGAACTAA ACTACTTTAA TCTAGTACAG TATGTAAGTA TATGTGTTGT GTATTTTTTT
TAGTCTCTAG GAGACCGTAA ACCTGAACGG TATGTATGCA CGTACGTACT TTTGATGAGT ATTAGTTGTA TAGTACATAG
TACACTACTA GCTGTAGCAG TACGTACATA CGGTGGTACA ATATTGTATT GATGAGCTGA AAATTGAAGG GTGGCATGGA
ATGGAATGGG CCTTACCTGC AGTATCTGTA TGTGCAGGCT GATTAATTAA CCAGCCAACC ACCAACACTG TCCAAATTTA
TTACTATACG GAGTACTAGT ATATATTACA AACAAATTTA ATTAGGTACT CTGATGGAAT TGACGCGGTG CATGCAGTTG
ACACGTCTGC GGGACGGGGT GGCAGTGGGG TGCGCCttca accacgccgt cctcgacggc acctccacct ggcacttcat
gacgtcatgg gcggagctct gccggggcgg cggcgcgccg tCGCTGCTGC CGGTGCACAA CCGCGGCATG GCGCGCTCCG
TCCGCGTCAA CCTCCCGCTC CCGGCGTCCG CCGAGGCGCA CGAGAAGACC GACCCCAATG GGCCCAAGGT GCCCCTCGTG
GCCCGCGTCT TCTCCTTCCC GCCCTCCGCC GTGGCCCGCG CCAAGGCCGC CGCCAACGCC GCCCTGCCCC CCGGCGCCAA
GCCCTTCTCC TCCTTCCAGT CGCTCGCCGC CCACATCTGG CGCGCCGTCT CCCGCGCCCG CGCCCTCGGC CCCTCCGACA
TCACCGTCTT CGCCGTCTTC GCCGACTGCC GCGCCCGCCT CAGCCCGCCC CTCCCGCCCG CCTACTTCGG CAACCTCATC
CAGGCCGTCT TCACCGGCGT GCCCGCGGGG ATGCTCCTCG CTGGCCCGCC CGAGCTCGCC GCGGGGCTGC TGCAGAAGGC
CATCGACGAC CACGACGCCG CCGCCATCAC CCGGAGGCTG GAGGAGTACG AGGCGGCGCC CAAGCTGTTC CACTACAGCG
ACGCCGGCCC CAACTGCGTC GCCGTCGGCA GCTCGCCGCG CTTCAGGGTG TACGACGTCG ACTTCGGCTT CGGCCGCCCG
GAGCGGGTGC GAAGCGGCGC CAACAACAAG TTCGACGGGA TGGTCTACCT CTACCCGGGC CGCGGCGGCG ACGGCGGCAT
CGACGTCGAG CTCTCGCTGC AGCCGGAGCC GATGCAGAGG TTGGACAAGG ACCAAGACTT CCTCCAAATG CGAGCCCCTT
AATTCTTTTT TTTTTCTTTT ATACTCCTAT ATATTATGAT GATTCATCAG CTGCATGTTA CTCCCTAGTA GTCTTGTTCC
TCCTAAATTG CAACTTCTCC TACTACTCCT TTATGTTTAG TTGGATGCAT GCATGGATTC CTTGTTGCTT GCTACTATTT
ATATATAGTG GAGTACTATG TTGTGTACTA TGTTGCTTGC AAGCTACATT TATATGTGGA TTTGCATATA TTGAATTGGT
CCATTACTTA AATAAGGATC GGATATGGAA TTAATTAGCA GCTATACAGT TTGTGTGTAC TTAATTATTA AGCCCATGCA
TCATATCTGG CCTGTTGCTT GATTGGAAAT GTAACCTATT AATGTATTTG TAATTTTTGT ACTCCAATGA TTACTGGAAT
TGCTTACATG TTT