Os08t0565700-01

Locus

Os08g0565700

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET32, SDG715, OsSUVH9

Oryzabase Gene Name Synonym(s)

SET protein 32, SUVH Histone Methyltransferase 9

Transcript Evidence

AK067640 (DDBJ, Best hit)

Protein Evidence

B8B9M4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Pre-SET domain (IPR007728)

Full-length cDNA

J013110N01 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0565700-01)

RiceXPro (AK067640)

Others

Oryzabase (13396)

KEGG (Os08t0565700-01 (EC:2.1.1.43))

Transcript

2093 bp

>Os08t0565700-01 SET domain containing protein.
CAAACCCAAACCCTCACCAATGGCGTCTCCGCCGCCGCCGCCTCGCCTCCTCACTCCCAA
GCCCGACCCCGACGCCCCCCTACCCCCGCTCCCTTACCCCGACCCCAACCTCGTCCAAAG
CATGCTCTTCTCCGCCCAGTCCCCGCAGGCGCAGCCGCAGGCGCCGCCACCCCACATCCA
ACCCCCCGCCTCCGCCTCCGCCGAGGCCCCCTCCGGCGACGAGAAGAATAAGAAGAAGAA
GAAGCGGGCCCGCGCCTCCCAGGAGATGGTGCgcatcaccaaccttagcatcgccgacca
cctccactaccgctccctcgtccgccgcgcccgcctcaccttcgaggccctccgcgccat
ctaccaacgccaggacctcgccaccgccgggggaatccgcaaccgcttcgacctccgggc
ctccagcaagatgctctccaagggcctctggatgcaccgcgacatccgcaccgtcggctc
catccccggcctcctcgtcggggactccttcttctaccgcgccgagctctgcgtcctcgg
cctccacaccgcccctcaggccggcatcggctacatccccgccagcatcgtcgaccaggg
ccaccccgtcgccaccagcatcgtctcctccgggggatacctcgacgacgaggacagcgg
cgacgtcctcgtctactccgGCAGCGGCGGCCGCCTGCGCAACCGCCTCGACCACAGCGC
CGACCAGACGCTCCAGCGCGGCAACCTCGCGCTCCACTACAGCTGCCACTACGGCATCGA
GGTGCGCGTCATCCGTGGCCACGCCTGCGACCACAGCCCCAGCAGCAAGGTCTACGTCTA
CGACGGCCTCTACAGGGTTGTCACCTCCACCTTCGGCCCTGGCAAATCCGGCCGCGACGT
CTGCAAGTTCAAGCTCGTGCGCATCCCTGGCCAGGACGACCTCGGCAGCAAGGCCTGGCA
TACCGCAGCGGAGCTCAAGGATGCACTGGATTCCAAGATCCGCCCGCCCAAGTACATCTC
GCTCGACATTGCCAAGGGCAAGGAACCATTCCGCGTGCCCCTCTATAACAAGCTCGACGA
CGACAGGTCACCCCTCTTCTACGACTACATTGCCTGTCCCGACTTCCCCACCACCCAGCA
GCTGCTCAAACGCCAGACCCAGAGGGGCTGCCACTGTGCCGAGCTGTGCGGCTCCAGGTG
CAGCTGTGAGAGGAAGAACAGGGGGGCCGACGGCCCTGTGTACACCTCCGATGGCATCCT
TCTCAGGGGACGCCCCTTGGTGTACGAGTGCGGACCCCTGTGTGGATGCCCCATGACCTG
TCCCAACAGAGTCACACAGCAAGGGATGAAGCACCGCCTCGAGGTGTTCCGTTCCAAGGA
GACAGGCTGGGGTGTCAGGACGCTTGACTTGATACAGCCGGGTGCCTTCATATGCGAGTA
CGCCGGCGACGTGCTCTCCTTGGACAGCCACTCAGGTGACGCCCCTCTGCCTCCGATGGA
GGACGGGAGCTCCATCATCGACCCGACCAAGTTCCCCGAGAGATGGAGGGAGTGGGGAGA
TGCATCCGTGGTTTACCCGGACAGGGTACCCCATTTCCCCCTATTTGCAGGGGCGCGCTA
CCGACTCGACGTGTCACAGAGGAGGAACGTGGCTTGCTACATTAGCCACAGCTGCAGTCC
GAATGTGTTCCTTCAATATGTAATCCGTGGCAATGAGGATGAATCCTACCCTCACATGAT
GGTGTTTGCCATGGAGACCATCCCTCCAATGCGGGATCTGTCCATCGACTATGGCTTGGA
CTAGGGTCCATGAGGGGGGAGGAGGGATCAATGGCTGGTAACTGGTTTTGGCGGGCTGAG
GCAACGTTAGGAAGCTGCAAATGGCCCCACAGACAGTTGGCTCGTCTTTTTGGATATTTT
GTAGGTGAGCAGGTATCTCTTTTTGGGTACCCATAGTGCTCTCATTTTGGGGTAACTAGG
GTGCAATTGATGAGTTTGTTCTAGGATTGGCATGAATGAAGAACTTTGCTAGGTAGCAAA
AGGGGCGCATCAATACTGCATCACTGGAAAGAACTATTCAAAACCATTAGTTG

CDS

1785 bp

>Os08t0565700-01 SET domain containing protein.
ATGGCGTCTCCGCCGCCGCCGCCTCGCCTCCTCACTCCCAAGCCCGACCCCGACGCCCCC
CTACCCCCGCTCCCTTACCCCGACCCCAACCTCGTCCAAAGCATGCTCTTCTCCGCCCAG
TCCCCGCAGGCGCAGCCGCAGGCGCCGCCACCCCACATCCAACCCCCCGCCTCCGCCTCC
GCCGAGGCCCCCTCCGGCGACGAGAAGAATAAGAAGAAGAAGAAGCGGGCCCGCGCCTCC
CAGGAGATGGTGCgcatcaccaaccttagcatcgccgaccacctccactaccgctccctc
gtccgccgcgcccgcctcaccttcgaggccctccgcgccatctaccaacgccaggacctc
gccaccgccgggggaatccgcaaccgcttcgacctccgggcctccagcaagatgctctcc
aagggcctctggatgcaccgcgacatccgcaccgtcggctccatccccggcctcctcgtc
ggggactccttcttctaccgcgccgagctctgcgtcctcggcctccacaccgcccctcag
gccggcatcggctacatccccgccagcatcgtcgaccagggccaccccgtcgccaccagc
atcgtctcctccgggggatacctcgacgacgaggacagcggcgacgtcctcgtctactcc
gGCAGCGGCGGCCGCCTGCGCAACCGCCTCGACCACAGCGCCGACCAGACGCTCCAGCGC
GGCAACCTCGCGCTCCACTACAGCTGCCACTACGGCATCGAGGTGCGCGTCATCCGTGGC
CACGCCTGCGACCACAGCCCCAGCAGCAAGGTCTACGTCTACGACGGCCTCTACAGGGTT
GTCACCTCCACCTTCGGCCCTGGCAAATCCGGCCGCGACGTCTGCAAGTTCAAGCTCGTG
CGCATCCCTGGCCAGGACGACCTCGGCAGCAAGGCCTGGCATACCGCAGCGGAGCTCAAG
GATGCACTGGATTCCAAGATCCGCCCGCCCAAGTACATCTCGCTCGACATTGCCAAGGGC
AAGGAACCATTCCGCGTGCCCCTCTATAACAAGCTCGACGACGACAGGTCACCCCTCTTC
TACGACTACATTGCCTGTCCCGACTTCCCCACCACCCAGCAGCTGCTCAAACGCCAGACC
CAGAGGGGCTGCCACTGTGCCGAGCTGTGCGGCTCCAGGTGCAGCTGTGAGAGGAAGAAC
AGGGGGGCCGACGGCCCTGTGTACACCTCCGATGGCATCCTTCTCAGGGGACGCCCCTTG
GTGTACGAGTGCGGACCCCTGTGTGGATGCCCCATGACCTGTCCCAACAGAGTCACACAG
CAAGGGATGAAGCACCGCCTCGAGGTGTTCCGTTCCAAGGAGACAGGCTGGGGTGTCAGG
ACGCTTGACTTGATACAGCCGGGTGCCTTCATATGCGAGTACGCCGGCGACGTGCTCTCC
TTGGACAGCCACTCAGGTGACGCCCCTCTGCCTCCGATGGAGGACGGGAGCTCCATCATC
GACCCGACCAAGTTCCCCGAGAGATGGAGGGAGTGGGGAGATGCATCCGTGGTTTACCCG
GACAGGGTACCCCATTTCCCCCTATTTGCAGGGGCGCGCTACCGACTCGACGTGTCACAG
AGGAGGAACGTGGCTTGCTACATTAGCCACAGCTGCAGTCCGAATGTGTTCCTTCAATAT
GTAATCCGTGGCAATGAGGATGAATCCTACCCTCACATGATGGTGTTTGCCATGGAGACC
ATCCCTCCAATGCGGGATCTGTCCATCGACTATGGCTTGGACTAG

Protein

595 aa

>Os08t0565700-01 SET domain containing protein.
MASPPPPPRLLTPKPDPDAPLPPLPYPDPNLVQSMLFSAQSPQAQPQAPPPHIQPPASAS
AEAPSGDEKNKKKKKRARASQEMVRITNLSIADHLHYRSLVRRARLTFEALRAIYQRQDL
ATAGGIRNRFDLRASSKMLSKGLWMHRDIRTVGSIPGLLVGDSFFYRAELCVLGLHTAPQ
AGIGYIPASIVDQGHPVATSIVSSGGYLDDEDSGDVLVYSGSGGRLRNRLDHSADQTLQR
GNLALHYSCHYGIEVRVIRGHACDHSPSSKVYVYDGLYRVVTSTFGPGKSGRDVCKFKLV
RIPGQDDLGSKAWHTAAELKDALDSKIRPPKYISLDIAKGKEPFRVPLYNKLDDDRSPLF
YDYIACPDFPTTQQLLKRQTQRGCHCAELCGSRCSCERKNRGADGPVYTSDGILLRGRPL
VYECGPLCGCPMTCPNRVTQQGMKHRLEVFRSKETGWGVRTLDLIQPGAFICEYAGDVLS
LDSHSGDAPLPPMEDGSSIIDPTKFPERWREWGDASVVYPDRVPHFPLFAGARYRLDVSQ
RRNVACYISHSCSPNVFLQYVIRGNEDESYPHMMVFAMETIPPMRDLSIDYGLD*

5'UTR

chr08:28343094..28343112 (- strand) : 19 bp

CDS

chr08:28341309..28343093 (- strand) : 1785 bp

3'UTR

chr08:28341020..28341308 (- strand) : 289 bp

FASTA

>Os08t0565700-01 class=Sequence position=chr08:28341020..28343112 (- strand)
CAAACCCAAA CCCTCACCAA TGGCGTCTCC GCCGCCGCCG CCTCGCCTCC TCACTCCCAA GCCCGACCCC GACGCCCCCC
TACCCCCGCT CCCTTACCCC GACCCCAACC TCGTCCAAAG CATGCTCTTC TCCGCCCAGT CCCCGCAGGC GCAGCCGCAG
GCGCCGCCAC CCCACATCCA ACCCCCCGCC TCCGCCTCCG CCGAGGCCCC CTCCGGCGAC GAGAAGAATA AGAAGAAGAA
GAAGCGGGCC CGCGCCTCCC AGGAGATGGT GCgcatcacc aaccttagca tcgccgacca cctccactac cgctccctcg
tccgccgcgc ccgcctcacc ttcgaggccc tccgcgccat ctaccaacgc caggacctcg ccaccgccgg gggaatccgc
aaccgcttcg acctccgggc ctccagcaag atgctctcca agggcctctg gatgcaccgc gacatccgca ccgtcggctc
catccccggc ctcctcgtcg gggactcctt cttctaccgc gccgagctct gcgtcctcgg cctccacacc gcccctcagg
ccggcatcgg ctacatcccc gccagcatcg tcgaccaggg ccaccccgtc gccaccagca tcgtctcctc cgggggatac
ctcgacgacg aggacagcgg cgacgtcctc gtctactccg GCAGCGGCGG CCGCCTGCGC AACCGCCTCG ACCACAGCGC
CGACCAGACG CTCCAGCGCG GCAACCTCGC GCTCCACTAC AGCTGCCACT ACGGCATCGA GGTGCGCGTC ATCCGTGGCC
ACGCCTGCGA CCACAGCCCC AGCAGCAAGG TCTACGTCTA CGACGGCCTC TACAGGGTTG TCACCTCCAC CTTCGGCCCT
GGCAAATCCG GCCGCGACGT CTGCAAGTTC AAGCTCGTGC GCATCCCTGG CCAGGACGAC CTCGGCAGCA AGGCCTGGCA
TACCGCAGCG GAGCTCAAGG ATGCACTGGA TTCCAAGATC CGCCCGCCCA AGTACATCTC GCTCGACATT GCCAAGGGCA
AGGAACCATT CCGCGTGCCC CTCTATAACA AGCTCGACGA CGACAGGTCA CCCCTCTTCT ACGACTACAT TGCCTGTCCC
GACTTCCCCA CCACCCAGCA GCTGCTCAAA CGCCAGACCC AGAGGGGCTG CCACTGTGCC GAGCTGTGCG GCTCCAGGTG
CAGCTGTGAG AGGAAGAACA GGGGGGCCGA CGGCCCTGTG TACACCTCCG ATGGCATCCT TCTCAGGGGA CGCCCCTTGG
TGTACGAGTG CGGACCCCTG TGTGGATGCC CCATGACCTG TCCCAACAGA GTCACACAGC AAGGGATGAA GCACCGCCTC
GAGGTGTTCC GTTCCAAGGA GACAGGCTGG GGTGTCAGGA CGCTTGACTT GATACAGCCG GGTGCCTTCA TATGCGAGTA
CGCCGGCGAC GTGCTCTCCT TGGACAGCCA CTCAGGTGAC GCCCCTCTGC CTCCGATGGA GGACGGGAGC TCCATCATCG
ACCCGACCAA GTTCCCCGAG AGATGGAGGG AGTGGGGAGA TGCATCCGTG GTTTACCCGG ACAGGGTACC CCATTTCCCC
CTATTTGCAG GGGCGCGCTA CCGACTCGAC GTGTCACAGA GGAGGAACGT GGCTTGCTAC ATTAGCCACA GCTGCAGTCC
GAATGTGTTC CTTCAATATG TAATCCGTGG CAATGAGGAT GAATCCTACC CTCACATGAT GGTGTTTGCC ATGGAGACCA
TCCCTCCAAT GCGGGATCTG TCCATCGACT ATGGCTTGGA CTAGGGTCCA TGAGGGGGGA GGAGGGATCA ATGGCTGGTA
ACTGGTTTTG GCGGGCTGAG GCAACGTTAG GAAGCTGCAA ATGGCCCCAC AGACAGTTGG CTCGTCTTTT TGGATATTTT
GTAGGTGAGC AGGTATCTCT TTTTGGGTAC CCATAGTGCT CTCATTTTGG GGTAACTAGG GTGCAATTGA TGAGTTTGTT
CTAGGATTGG CATGAATGAA GAACTTTGCT AGGTAGCAAA AGGGGCGCAT CAATACTGCA TCACTGGAAA GAACTATTCA
AAACCATTAG TTG

Locus: Os08g0565700

Loading...

Locus: Os08g0565700

Loading...