Os08t0566600-01

Locus

Os08g0566600

Description

Cyclic electron transport in photosystem I (PSI), Redox homeostasis in chloroplasts

RAP-DB Gene Symbol Synonym(s)

PGR5

RAP-DB Gene Name Synonym(s)

PROTON GRADIENT REGULATION 5

CGSNL Gene Symbol

PGR5

CGSNL Gene Name

PROTON GRADIENT REGULATION 5

Oryzabase Gene Symbol Synonym(s)

OsPGR5

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK061598

AK066210

Protein Evidence

Q6Z1P2

Literature

PMID: 23161858

Note

Manual Curation

August 4, 2020

Full-length cDNA

001-027-A06 (Online Clone Ordering)

J013056J23 (Online Clone Ordering)

Expression Databases

TENOR (Os08t0566600-01)

RiceXPro (AK061598)

Others

Oryzabase (20927)

KEGG (Os08t0566600-01)

Transcript

760 bp

>Os08t0566600-01 Cyclic electron transport in photosystem I (PSI), Redox homeostasis in chloroplasts
GTCCCGGCCCTCTACTCCACTCCACCCACCGGATTGCTAACTTGCTTCCTCCGTCCGCGG
CCACCACTTTCTCCTCTCCTCCTCAGAGCAAGATCATTCAAGTATAATCCTGCCTCCTAC
TAGCTATAATGGCAGCAGCTGCAGCATCATCCGTGTCCCTCCCCGGGGCGAGGGCTCTCC
CGACGTGGTCCAGCTCCGTGTCCGGCGACTCGCACTCGTTGGCGCTGAGCTCGTGGGCGG
CGCGGCCTCGGTCGGCGCGGCCACTGCGGGCGCCGGCGAGGATGGGCAACGTGAACGAGG
GCAAGGGGATCTTCGCACCGGTGGTGGTGGTGGTGCGCAACATCGTTGGCCGCAAGCGCT
TCAACCAGCTCAGGGGAAAGGCCATCGCGCTGCACTCGCAGGTGATCACCGAGTTCTGCA
AGACCATCGGCGCCGACGCCAAGCAGAGGCAGGGCTTGATCCGCCTTGCCAAGAAGAACG
GCGAGAAGCTCGGTTTCCTTGCCTGATCGACATGCCCTTCCTAATTCCTACTAGCTCATT
TGATTGGTGTGGATTTCCTCTCTGAATGAATGAATTTCCTGTAGCTAGCTAGCCAGCCGC
GCCTTCCTCCCTGCGTATAAATGTGTCTTGTGCGTACGTATACCTCCTCTTCTGACCTTC
AATTCCATCCATCCATGCCATGGCGGCATGAACGAATGAATTAGTAGTAAGTAATACGCG
CATGCATGAACGAATGAATAATATACTATATAATGCGTGT

CDS

378 bp

>Os08t0566600-01 Cyclic electron transport in photosystem I (PSI), Redox homeostasis in chloroplasts
ATGGCAGCAGCTGCAGCATCATCCGTGTCCCTCCCCGGGGCGAGGGCTCTCCCGACGTGG
TCCAGCTCCGTGTCCGGCGACTCGCACTCGTTGGCGCTGAGCTCGTGGGCGGCGCGGCCT
CGGTCGGCGCGGCCACTGCGGGCGCCGGCGAGGATGGGCAACGTGAACGAGGGCAAGGGG
ATCTTCGCACCGGTGGTGGTGGTGGTGCGCAACATCGTTGGCCGCAAGCGCTTCAACCAG
CTCAGGGGAAAGGCCATCGCGCTGCACTCGCAGGTGATCACCGAGTTCTGCAAGACCATC
GGCGCCGACGCCAAGCAGAGGCAGGGCTTGATCCGCCTTGCCAAGAAGAACGGCGAGAAG
CTCGGTTTCCTTGCCTGA

Protein

126 aa

>Os08t0566600-01 Cyclic electron transport in photosystem I (PSI), Redox homeostasis in chloroplasts
MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSARPLRAPARMGNVNEGKG
IFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGADAKQRQGLIRLAKKNGEK
LGFLA*

5'UTR

chr08:28377834..28377961 (+ strand) : 128 bp

CDS

chr08:28377962..28378234 (+ strand) : 273 bp

chr08:28378425..28378529 (+ strand) : 105 bp

3'UTR

chr08:28378530..28378783 (+ strand) : 254 bp

FASTA

>Os08t0566600-01 class=Sequence position=chr08:28377834..28378783 (+ strand)
GTCCCGGCCC TCTACTCCAC TCCACCCACC GGATTGCTAA CTTGCTTCCT CCGTCCGCGG CCACCACTTT CTCCTCTCCT
CCTCAGAGCA AGATCATTCA AGTATAATCC TGCCTCCTAC TAGCTATAAT GGCAGCAGCT GCAGCATCAT CCGTGTCCCT
CCCCGGGGCG AGGGCTCTCC CGACGTGGTC CAGCTCCGTG TCCGGCGACT CGCACTCGTT GGCGCTGAGC TCGTGGGCGG
CGCGGCCTCG GTCGGCGCGG CCACTGCGGG CGCCGGCGAG GATGGGCAAC GTGAACGAGG GCAAGGGGAT CTTCGCACCG
GTGGTGGTGG TGGTGCGCAA CATCGTTGGC CGCAAGCGCT TCAACCAGCT CAGGGGAAAG GCCATCGCGC TGCACTCGCA
GGTACGCACG TCTACTCTAC TCCGATCCTC ATCAATTATA GTACACTAGT TTTAATTAAT TAGCTATCAT CATCTGCCAT
GCCATATATA TAAGCAAATT TTGCAATCAA ACATATCAAT ATGCTTGCTA TCTATCTTGT GAGTGAGTGA CTTGTGGCCA
TCGATGATAC GGACGGTACT GCTTGTTGCA GGTGATCACC GAGTTCTGCA AGACCATCGG CGCCGACGCC AAGCAGAGGC
AGGGCTTGAT CCGCCTTGCC AAGAAGAACG GCGAGAAGCT CGGTTTCCTT GCCTGATCGA CATGCCCTTC CTAATTCCTA
CTAGCTCATT TGATTGGTGT GGATTTCCTC TCTGAATGAA TGAATTTCCT GTAGCTAGCT AGCCAGCCGC GCCTTCCTCC
CTGCGTATAA ATGTGTCTTG TGCGTACGTA TACCTCCTCT TCTGACCTTC AATTCCATCC ATCCATGCCA TGGCGGCATG
AACGAATGAA TTAGTAGTAA GTAATACGCG CATGCATGAA CGAATGAATA ATATACTATA TAATGCGTGT 

Locus: Os08g0566600

Loading...

Locus: Os08g0566600

Loading...