Os09t0103400-01

Locus

Os09g0103400

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MIR2055

CGSNL Gene Name

MICRORNA2055

Oryzabase Gene Symbol Synonym(s)

miR2055, OsmiR2055, osa-miR2055, osa-MIR2055

Oryzabase Gene Name Synonym(s)

microRNA1425, osa-miRNA1425

Transcript Evidence

AK064377 (DDBJ, Best hit)

Protein Evidence

A3BVX5 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-108-D08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0103400-01)

RiceXPro (AK064377)

Others

Oryzabase (8532)

KEGG (Os09t0103400-01)

Transcript

1366 bp

>Os09t0103400-01 Conserved hypothetical protein.
GAGCACAAGAAACCCTACCGCCGCCGCCGCTTCCTCTCCTCTTCTTCTTCCACCACCGGA
GCAGAGGAAACCAAACCATGGCCCCCATCGTGCGCCCCTCCAAATCTGGCTCCAACTCCG
ATTCCGATTCCCACGCTCACCACCCTCCTCCTGAGCCGCCGCAAGAAAGCTCTGACGGCG
AGGACTTGGAGCTCGAGTCCTCCGAGGAACTTGATTCGCATGGGGCGCCCACCAAGAAAG
CCCCCTTCGTCGCCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCCAGCAGAATGGGA
AGGAGGTCTCCGATTCGCCATCGCTGCCCACCAATAGTGCCATCGTCCTCTCCCCGCTAC
CACCACCGCTGCAGGCGAACAAGAATCACCAAGACCAAGATTCTGAGTCTGATTCCGATT
CTGATGACGACGAGCCACCGCTGCCCACCAACAATGCAATCGTCCTCGCCCCGCCGAACA
ACCAGGAGTCTGAGTCTGATTCTGATTCTGATGACGACCAAGAGTCAGCGCTGAAGGCGA
ACAAGATTGTGTCCTCGTCCGGCGATGACGACCAAGAGTCCGATTCCAGTGACGACGAGA
CGCTGCCAGCGCTTCAGGCCAACAAGAATGCGTCTCCGTCCGATGATGATGAGGATGACG
ACCAAGAGTCCGATTCCGGTGACGACGATGTGCTGCTGGACCCCGCGCTTCAGGCGAACA
AGAATGTGCTTGCCTTCAATGGGAAGAGGAAGGTGCCGCCGCAAGAGGTTGGTCAGTCTC
TTCGGCAGCCCAAGAAGAAGAAGATGGAGGCACCAGCCCAAGGAAACACAGACATTGACA
CGCAATTCAAGGAGAAGATTGCGTCCTACTTTTTCCTTGGGAAGGTGGTTTCTCTTCTGG
ATGAAGAGCACCCCGACTTGTTTAAGGAGGCTTTCTTGAAGCTTGCTGACAGCAAGGCCA
GTGCCCTGGATGCTAAGATCAAGCAGCTGACTTTGGCTCAGGTCAGGGTGTCTTTGAAGG
GGCGTGACCTGGAGAAGGAACTGATCAAGTTGCTGTCGGGCTTCCTCAAGTGATCATTAT
AGACATGGAGAAAACTTCAAGGAAGTGGGGGCTGACTGGACTGGGGTACAGTATGCTAAT
GCACCTGGTCATTTTGCTTTTGATTCTGGCTCATATCAACCTCGTTGGTATCGTCTCATT
TTGGTCCAAGATGGACATGTTTAATCTACTGATGTAAATACTCTGGTGATTTGGGACCAC
CAAGACTAGCTACTCTACCCCATATTTAGATAGTACTAGCTTATATTCCACTGAACTACC
TGCACAACAGTTATTAATCATGGTAAACTTCAGTTAAGCTTCATTC

CDS

996 bp

>Os09t0103400-01 Conserved hypothetical protein.
ATGGCCCCCATCGTGCGCCCCTCCAAATCTGGCTCCAACTCCGATTCCGATTCCCACGCT
CACCACCCTCCTCCTGAGCCGCCGCAAGAAAGCTCTGACGGCGAGGACTTGGAGCTCGAG
TCCTCCGAGGAACTTGATTCGCATGGGGCGCCCACCAAGAAAGCCCCCTTCGTCGCCCCG
CCGCCGCCGCCGCCGCCGCCGCCGCCGCCCCAGCAGAATGGGAAGGAGGTCTCCGATTCG
CCATCGCTGCCCACCAATAGTGCCATCGTCCTCTCCCCGCTACCACCACCGCTGCAGGCG
AACAAGAATCACCAAGACCAAGATTCTGAGTCTGATTCCGATTCTGATGACGACGAGCCA
CCGCTGCCCACCAACAATGCAATCGTCCTCGCCCCGCCGAACAACCAGGAGTCTGAGTCT
GATTCTGATTCTGATGACGACCAAGAGTCAGCGCTGAAGGCGAACAAGATTGTGTCCTCG
TCCGGCGATGACGACCAAGAGTCCGATTCCAGTGACGACGAGACGCTGCCAGCGCTTCAG
GCCAACAAGAATGCGTCTCCGTCCGATGATGATGAGGATGACGACCAAGAGTCCGATTCC
GGTGACGACGATGTGCTGCTGGACCCCGCGCTTCAGGCGAACAAGAATGTGCTTGCCTTC
AATGGGAAGAGGAAGGTGCCGCCGCAAGAGGTTGGTCAGTCTCTTCGGCAGCCCAAGAAG
AAGAAGATGGAGGCACCAGCCCAAGGAAACACAGACATTGACACGCAATTCAAGGAGAAG
ATTGCGTCCTACTTTTTCCTTGGGAAGGTGGTTTCTCTTCTGGATGAAGAGCACCCCGAC
TTGTTTAAGGAGGCTTTCTTGAAGCTTGCTGACAGCAAGGCCAGTGCCCTGGATGCTAAG
ATCAAGCAGCTGACTTTGGCTCAGGTCAGGGTGTCTTTGAAGGGGCGTGACCTGGAGAAG
GAACTGATCAAGTTGCTGTCGGGCTTCCTCAAGTGA

Protein

331 aa

>Os09t0103400-01 Conserved hypothetical protein.
MAPIVRPSKSGSNSDSDSHAHHPPPEPPQESSDGEDLELESSEELDSHGAPTKKAPFVAP
PPPPPPPPPPQQNGKEVSDSPSLPTNSAIVLSPLPPPLQANKNHQDQDSESDSDSDDDEP
PLPTNNAIVLAPPNNQESESDSDSDDDQESALKANKIVSSSGDDDQESDSSDDETLPALQ
ANKNASPSDDDEDDDQESDSGDDDVLLDPALQANKNVLAFNGKRKVPPQEVGQSLRQPKK
KKMEAPAQGNTDIDTQFKEKIASYFFLGKVVSLLDEEHPDLFKEAFLKLADSKASALDAK
IKQLTLAQVRVSLKGRDLEKELIKLLSGFLK*

5'UTR

chr09:432253..432329 (- strand) : 77 bp

CDS

chr09:431257..432252 (- strand) : 996 bp

3'UTR

chr09:431248..431256 (- strand) : 9 bp

chr09:429888..430171 (- strand) : 284 bp

FASTA

>Os09t0103400-01 class=Sequence position=chr09:429888..432329 (- strand)
GAGCACAAGA AACCCTACCG CCGCCGCCGC TTCCTCTCCT CTTCTTCTTC CACCACCGGA GCAGAGGAAA CCAAACCATG
GCCCCCATCG TGCGCCCCTC CAAATCTGGC TCCAACTCCG ATTCCGATTC CCACGCTCAC CACCCTCCTC CTGAGCCGCC
GCAAGAAAGC TCTGACGGCG AGGACTTGGA GCTCGAGTCC TCCGAGGAAC TTGATTCGCA TGGGGCGCCC ACCAAGAAAG
CCCCCTTCGT CGCCCCGCCG CCGCCGCCGC CGCCGCCGCC GCCGCCCCAG CAGAATGGGA AGGAGGTCTC CGATTCGCCA
TCGCTGCCCA CCAATAGTGC CATCGTCCTC TCCCCGCTAC CACCACCGCT GCAGGCGAAC AAGAATCACC AAGACCAAGA
TTCTGAGTCT GATTCCGATT CTGATGACGA CGAGCCACCG CTGCCCACCA ACAATGCAAT CGTCCTCGCC CCGCCGAACA
ACCAGGAGTC TGAGTCTGAT TCTGATTCTG ATGACGACCA AGAGTCAGCG CTGAAGGCGA ACAAGATTGT GTCCTCGTCC
GGCGATGACG ACCAAGAGTC CGATTCCAGT GACGACGAGA CGCTGCCAGC GCTTCAGGCC AACAAGAATG CGTCTCCGTC
CGATGATGAT GAGGATGACG ACCAAGAGTC CGATTCCGGT GACGACGATG TGCTGCTGGA CCCCGCGCTT CAGGCGAACA
AGAATGTGCT TGCCTTCAAT GGGAAGAGGA AGGTGCCGCC GCAAGAGGTT GGTCAGTCTC TTCGGCAGCC CAAGAAGAAG
AAGATGGAGG CACCAGCCCA AGGAAACACA GACATTGACA CGCAATTCAA GGAGAAGATT GCGTCCTACT TTTTCCTTGG
GAAGGTGGTT TCTCTTCTGG ATGAAGAGCA CCCCGACTTG TTTAAGGAGG CTTTCTTGAA GCTTGCTGAC AGCAAGGCCA
GTGCCCTGGA TGCTAAGATC AAGCAGCTGA CTTTGGCTCA GGTCAGGGTG TCTTTGAAGG GGCGTGACCT GGAGAAGGAA
CTGATCAAGT TGCTGTCGGG CTTCCTCAAG TGATCATTAT AGGTTGATTG ACTGACCTTT CTCACCTCTA ATTTACCTTG
CCATCTTTTA CTTGTTGATC TGTCTTTACC ATACAAGATT GCCATCACTG TTATCTACAT ATTCCATCGT GACGCTGACT
TGAGGTTCTA ATCTTGTGGA GGCGGTAGTT TAGTTGTGAT ATACTGATAC CCTTTTAGGA AGAGCTTGCT GGTAAGGTTC
ACATTGCTTT AGAGCAGCTG CGTCCATTTG CTGCCAAGAG GATATAGAAT ACACTCAAAA GGCCAAGTTT GTACTTTAAT
GGTTTGTGAT GAATGATGCT TCTATTAGAG TATACGTTTA TGATGAATTA GTGAACTTTT GGTATAGGTA AACAGCCCAA
ATGATGTGCC AACTGATTTA AAGTGCATTA TTGTTTTCGA AGTTTCAAGG TTATAATGTT GCATTTTGTA AAGTGAATTG
CATAACGTCA GTTTGCCTGG TGCTAGCTAG TATTTGTTTT GTTCTGTTTT AAGTTTTTGT TCTGTTTTAA GTCTATTCAT
TTCATTATTC TTATGTGTTT CCAAACTGTG ATGCATTTTA TTGCTTTCTT TGTAACACCA TGATATGAAT TGTCTGCCTG
TTCATTTAAT TTTAGATTCC TCTCTTTACA CGTGAAGCCA TGCCACTCTC TTTTCTTATC CTTGTTAAAT TATTTTCGTT
TGCAAGCTGC TGAAATGATG GAAATGCAAG ATTCTTTTGG AAATATAGTT GCGGATAGTT ACTGATTGAT ATATAAGAAT
GTCCCCAGAA ACTAGATTCT GTAGTATAAA CAATTGCAAA CTTTCTAGGC AATTAAAACT ACTGATTGTG CTTTCAACGT
TTTGATGCCC TTCTTCCTTG TGTATGTAAA GGAGTTATTT GACATCAATA TCAGTGGGTG CTTATTTGTT TAAAAGGTTT
CAATGGCCTA TCAGACTATC AGTGTAAATT GAGTCTATTT TTGCAAACAC TGGTTTGGTC TTCTATGATC TTGGGCTATG
TGCAGTTGTG TTTCTGATGA CTAATCTAGC CAAGCAATTA TGTAACTTGA TTTACGTTTT CTTTTTTCAT TTTTGCAGAC
ATGGAGAAAA CTTCAAGGAA GTGGGGGCTG ACTGGACTGG GGTACAGTAT GCTAATGCAC CTGGTCATTT TGCTTTTGAT
TCTGGCTCAT ATCAACCTCG TTGGTATCGT CTCATTTTGG TCCAAGATGG ACATGTTTAA TCTACTGATG TAAATACTCT
GGTGATTTGG GACCACCAAG ACTAGCTACT CTACCCCATA TTTAGATAGT ACTAGCTTAT ATTCCACTGA ACTACCTGCA
CAACAGTTAT TAATCATGGT AAACTTCAGT TAAGCTTCAT TC

Locus: Os09g0103400

Loading...

Locus: Os09g0103400

Loading...