Os09t0255000-01

Locus

Os09g0255000

Description

Similar to Cell wall invertase (EC 3.2.1.26).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OSINV1, OsINV1, INV1, OsCIN7, OsCIN8

Oryzabase Gene Name Synonym(s)

cell wall invertase 1, cell-wall invertase 7, cell-wall invertase 8

Transcript Evidence

AK069080 (DDBJ, Best hit)

Protein Evidence

Q0J360 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase, family 32 (IPR001362)

Concanavalin A-like lectin/glucanase (IPR008985)

Glycosyl hydrolases family 32, N-terminal (IPR013148)

Glycosyl hydrolase family 32, C-terminal (IPR013189)

Glycosyl hydrolase family 43, five-bladed beta-propellor domain (IPR023296)

Full-length cDNA

J023004I08 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0255000-01)

RiceXPro (AK069080)

Others

Oryzabase (11686)

KEGG (Os09t0255000-01 (EC:3.2.1.26))

Transcript

2100 bp

>Os09t0255000-01 Similar to Cell wall invertase (EC 3.2.1.26).
TCAGACTCATGACTCAGGGCACCAACCAAACAGGCGTTTTCTTCAGAGTTTCAGAGCAGA
AGCAGAGACACCAACAAGAAGGCGATCAGCTCGTTCTTCTTCTCCCTCTCCTCCAGCGGC
GGCCATGGCGAGATTAGGCCTTGCCGTCTGCGCCGCCTCCTTCCACCTCTTCCTTCTTCT
TGCGTCGACCTCCTCGCTCCGGCGAGCTCCCACGGAGGCGGACACGGCCAACCATGCCAG
AAGAACTGCCTATCACTTCCAGCCTGCAAAGAACTGGCAGAATGATCCGAATGGGCCTAT
GTACCATAACGGTATGTACCATTTGTTCTACCAGTACAACCCGCATAGCGCGCTCTGGGA
CATCGGCAACCTCTCCTGGGGCCACTCCGTCTCCGGCGACCTCCTCAACTGGGCCGCTCT
CGACACCGCGCTCGACCCCACCTCGCCTTTCGACGCCAATGGCTGCTGGTCGGGCTCCGC
CACCATCCTCCCCGGCGCCCTCCCGGCCATCCTCTACACCGGCATCGACGCCAGCAAGGA
GCAGGTCCAGAACGTCGCCTTCGCCAAGAACCCCTCCGATCCGCTCCTCCGCGAGTGGGA
GAAGCCCGCGTACAATCCGGTCATCGCGCTCCCGGCCGATGTCCCCGGCGACAAGTTCCG
TGACCCCTCGACGGCATGGCTCGGCCGTGACGGCCTGTGGCGGATCGCCGTCTCCGCCGA
GGTGGACGGCGTCGCGTCCACGCTCGTCTACAGGAGCAAGGACTTCGTCCGGTGGGAGCG
GAACGCCGCGCCGCTGCACGCGTCGCGCGCCGCGGGCATGGTGGAGTGCCCGGACCTGTT
CCCCGTAGCGGAGCGCGGCGAGGATGGCCTCGACACGTCGGCGAACGGCGCCGGCGGCGT
GCGCCACGTCCTGAAGCTGAGCGTGATGGACACGCTCCAGGACTACTACATGGTCGGCAC
GTACGACGACGCGGCAGACGCCTTCTCGCCGGCGGAGCCTGAGCGCGGCGACGACTGCCG
GAGCTGGCGGCGGCTGGACTACGGGCACGTGTACGCGTCCAAGTCGTTCTTCGACGTGCG
CAAGAACCGGCGCGTTCTGTGGGCGTGGGCGAACGAGTCCGACAGCCAGGCCGACGACGT
CGCCCGCGGCTGGTCCGGCGTGCAGACATTCCCGAGGAAGATGTGGCTAGCCAAGGACGG
CAAGCAGCTGCTGCAGTGGCCGATCGAGGAGATCAAGACGCTGAGGAGGAAGCGCGCCGG
TCTCTGGCAAGGCACCAGGCTAGGCGCCGGCGCGGTGCAGGAGATCGTCGGCGTGGCGAG
CTCGCAGGCGGACGTGGAGGTGGTGTTCAAGATTCCGAGCCTGGAGGAGGCCGAGAGGGT
GGACGACCCCAACCGGCTGCTGGATCCCCAGAAGCTGTGCGGTGAGAAGGGCGCCGCCGT
GCGGGGCGGCGTCGGCCCGTTCGGGCTCCTCGTAATGGCCTCCGGCGACCTGCACGAGCA
CACCGCCGTCTTCTTCAGGGTGTTCAGGCACCATGACAAGTACAAGCTTCTTATGTGCAC
CGACTTGACAAAGTCGTCGACAAGAGCAGGGGTGTACAAGCCGGCTTACGGCGGATTCGT
GGACATGGACATCGACGATCACAAAACCATATCGCTGAGAACGTTGATTGACCATTCGGT
GGTGGAGAGCTTCGGCGGCGGCGGGCGGGCGTGCATCACGGCGCGGGTTTACCCGGAGCA
CGTGGCGACGAGCAGCAGCCATTTGTACGTGTTCAACAACGGGAGCGACGCCGTTAAGGT
GGCCAAGCTGGAGGCGTGGGACCTGGCGACGGCGACCGTCAACGTTGTTGTTGGAGACCA
CCACGGCCTTGTTGCGCCGGCGTTGGAGTTGGAGCCGACACGCACGACGCAGTGATCTGA
GGCCTGAAGCGGCTGGCCGGCACTGGCACAGTTGGTTCGATAGTTTGATGGCATCGTGCA
GCCGATTGGTTGTGTGGTGATTTGTTCGATTGTTGTGAACAGGGTGTATGATCTGTGACA
GAAAGAAGAGCACAAAAGAAATCATTCGATAGTATACGTCACGTGCTTTATATGTTTTGC

CDS

1791 bp

>Os09t0255000-01 Similar to Cell wall invertase (EC 3.2.1.26).
ATGGCGAGATTAGGCCTTGCCGTCTGCGCCGCCTCCTTCCACCTCTTCCTTCTTCTTGCG
TCGACCTCCTCGCTCCGGCGAGCTCCCACGGAGGCGGACACGGCCAACCATGCCAGAAGA
ACTGCCTATCACTTCCAGCCTGCAAAGAACTGGCAGAATGATCCGAATGGGCCTATGTAC
CATAACGGTATGTACCATTTGTTCTACCAGTACAACCCGCATAGCGCGCTCTGGGACATC
GGCAACCTCTCCTGGGGCCACTCCGTCTCCGGCGACCTCCTCAACTGGGCCGCTCTCGAC
ACCGCGCTCGACCCCACCTCGCCTTTCGACGCCAATGGCTGCTGGTCGGGCTCCGCCACC
ATCCTCCCCGGCGCCCTCCCGGCCATCCTCTACACCGGCATCGACGCCAGCAAGGAGCAG
GTCCAGAACGTCGCCTTCGCCAAGAACCCCTCCGATCCGCTCCTCCGCGAGTGGGAGAAG
CCCGCGTACAATCCGGTCATCGCGCTCCCGGCCGATGTCCCCGGCGACAAGTTCCGTGAC
CCCTCGACGGCATGGCTCGGCCGTGACGGCCTGTGGCGGATCGCCGTCTCCGCCGAGGTG
GACGGCGTCGCGTCCACGCTCGTCTACAGGAGCAAGGACTTCGTCCGGTGGGAGCGGAAC
GCCGCGCCGCTGCACGCGTCGCGCGCCGCGGGCATGGTGGAGTGCCCGGACCTGTTCCCC
GTAGCGGAGCGCGGCGAGGATGGCCTCGACACGTCGGCGAACGGCGCCGGCGGCGTGCGC
CACGTCCTGAAGCTGAGCGTGATGGACACGCTCCAGGACTACTACATGGTCGGCACGTAC
GACGACGCGGCAGACGCCTTCTCGCCGGCGGAGCCTGAGCGCGGCGACGACTGCCGGAGC
TGGCGGCGGCTGGACTACGGGCACGTGTACGCGTCCAAGTCGTTCTTCGACGTGCGCAAG
AACCGGCGCGTTCTGTGGGCGTGGGCGAACGAGTCCGACAGCCAGGCCGACGACGTCGCC
CGCGGCTGGTCCGGCGTGCAGACATTCCCGAGGAAGATGTGGCTAGCCAAGGACGGCAAG
CAGCTGCTGCAGTGGCCGATCGAGGAGATCAAGACGCTGAGGAGGAAGCGCGCCGGTCTC
TGGCAAGGCACCAGGCTAGGCGCCGGCGCGGTGCAGGAGATCGTCGGCGTGGCGAGCTCG
CAGGCGGACGTGGAGGTGGTGTTCAAGATTCCGAGCCTGGAGGAGGCCGAGAGGGTGGAC
GACCCCAACCGGCTGCTGGATCCCCAGAAGCTGTGCGGTGAGAAGGGCGCCGCCGTGCGG
GGCGGCGTCGGCCCGTTCGGGCTCCTCGTAATGGCCTCCGGCGACCTGCACGAGCACACC
GCCGTCTTCTTCAGGGTGTTCAGGCACCATGACAAGTACAAGCTTCTTATGTGCACCGAC
TTGACAAAGTCGTCGACAAGAGCAGGGGTGTACAAGCCGGCTTACGGCGGATTCGTGGAC
ATGGACATCGACGATCACAAAACCATATCGCTGAGAACGTTGATTGACCATTCGGTGGTG
GAGAGCTTCGGCGGCGGCGGGCGGGCGTGCATCACGGCGCGGGTTTACCCGGAGCACGTG
GCGACGAGCAGCAGCCATTTGTACGTGTTCAACAACGGGAGCGACGCCGTTAAGGTGGCC
AAGCTGGAGGCGTGGGACCTGGCGACGGCGACCGTCAACGTTGTTGTTGGAGACCACCAC
GGCCTTGTTGCGCCGGCGTTGGAGTTGGAGCCGACACGCACGACGCAGTGA

Protein

597 aa

>Os09t0255000-01 Similar to Cell wall invertase (EC 3.2.1.26).
MARLGLAVCAASFHLFLLLASTSSLRRAPTEADTANHARRTAYHFQPAKNWQNDPNGPMY
HNGMYHLFYQYNPHSALWDIGNLSWGHSVSGDLLNWAALDTALDPTSPFDANGCWSGSAT
ILPGALPAILYTGIDASKEQVQNVAFAKNPSDPLLREWEKPAYNPVIALPADVPGDKFRD
PSTAWLGRDGLWRIAVSAEVDGVASTLVYRSKDFVRWERNAAPLHASRAAGMVECPDLFP
VAERGEDGLDTSANGAGGVRHVLKLSVMDTLQDYYMVGTYDDAADAFSPAEPERGDDCRS
WRRLDYGHVYASKSFFDVRKNRRVLWAWANESDSQADDVARGWSGVQTFPRKMWLAKDGK
QLLQWPIEEIKTLRRKRAGLWQGTRLGAGAVQEIVGVASSQADVEVVFKIPSLEEAERVD
DPNRLLDPQKLCGEKGAAVRGGVGPFGLLVMASGDLHEHTAVFFRVFRHHDKYKLLMCTD
LTKSSTRAGVYKPAYGGFVDMDIDDHKTISLRTLIDHSVVESFGGGGRACITARVYPEHV
ATSSSHLYVFNNGSDAVKVAKLEAWDLATATVNVVVGDHHGLVAPALELEPTRTTQ*

5'UTR

chr09:4165397..4165520 (+ strand) : 124 bp

CDS

chr09:4165521..4165680 (+ strand) : 160 bp

chr09:4165840..4165848 (+ strand) : 9 bp

chr09:4168954..4170232 (+ strand) : 1279 bp

chr09:4170301..4170394 (+ strand) : 94 bp

chr09:4170485..4170733 (+ strand) : 249 bp

3'UTR

chr09:4170734..4170918 (+ strand) : 185 bp

FASTA

>Os09t0255000-01 class=Sequence position=chr09:4165397..4170918 (+ strand)
TCAGACTCAT GACTCAGGGC ACCAACCAAA CAGGCGTTTT CTTCAGAGTT TCAGAGCAGA AGCAGAGACA CCAACAAGAA
GGCGATCAGC TCGTTCTTCT TCTCCCTCTC CTCCAGCGGC GGCCATGGCG AGATTAGGCC TTGCCGTCTG CGCCGCCTCC
TTCCACCTCT TCCTTCTTCT TGCGTCGACC TCCTCGCTCC GGCGAGCTCC CACGGAGGCG GACACGGCCA ACCATGCCAG
AAGAACTGCC TATCACTTCC AGCCTGCAAA GAACTGGCAG AATGGTATCA TCTCTTCTCC CCGAGTCGTT CTTGTGATTA
ATCGCTTTGA TCCAGTTCCG GATTTAGCCA AACTAATCGC TTTTCCTGTC TGATCGGGGC CGAATTGCTG CTGATTCGGA
TGGATTGGAT TTATGATGGC CGATGATGAT GCCGATCGAG CAGATCCGAA TGGTACGATC TCTTCCTGTT CCTCTTTCTT
CTTATCTTTC CTCTGATTAC TGGAGGTTTT GCATAATTGT TCTCTAATAG AATTGCAAAA ACTATGTCCT TTCCTGGTTC
CCTTATATGC CTCGATTAGC CGGGCATAAG CATCGATTTG GACATCAGAA TAGGTTAAGC TTATCCATTT GGAGATGTGT
GGTCAGCGAT GCTAGGGTGG ATTGACAAGT GTTCCTCAAC CATTTGGCCA TAACTGAAAA AGAAATATCA TTCTGTTCAA
ACTCAGTAGA TTTTAGTGAC ACCATGTCCA TAACACTGCA GTTTTCTCTA ATTTGTCTCG CCCGTAGTCA CATTGTGCAT
TTTGATTTCC AATTCATGAT TTGTTATCTC CTTTCAATAA ATTATAAAAG GCAGCATATG CCACAGGATT GCTTGCTCAC
TGCTGCTAGC CTGCTACTAC AATTTTACAC AGTATATTTT CTTAGTCGGA AATTTTATGT ACCAAAATTT CAGTAATTTC
AACCCTCCAA AAGAACAGTT CCACTCAAAT ATTTTGGTAT ATTTCATATT TAGTTCAATG TCAGCAATAT TTCAATTTTT
TCACCTGATA TTAGTAATTT TACCCCCTCC GATTTTTTTT TTCAATACGG CTGAAGTGTA GGCCTGTCTA TAGTATACAT
GTTACCTTAA AAATGGATAA GTCCAGTTGA TCGTTATGAA CTATTCACTT TGTTTACCGT CACAACCCTA TATTTTAGAA
CTAGGTGATT GGAACCCTTC AATTTTCAAT ACCATTCGCT TTATCCCCTC CTCTGGTCCA ACATAGGATG GTTTTCACCA
ACATAGCATC AACATGACAG TCCAACCAAC CAAAATTAAT TTTAAAATAG GTGGAACCCG TATGTCACTT ACAGTTCATC
TATCTTCTTC CTCCACCTTT CCTCTTCCCC TCTGTACCTT CTCTCTCAGC GCATCCAGCT CGTATGCCTC CTTTGCACCC
GCACCTCTTT ACCAAAGTCA CACATGCATG GAGCATGAGA TGATTCACGG TAGTCGTGTA TGAGGCGTGG ATCTCACCGA
AGCCATGAGC TTGGACTCGG TGATGTCTAT GCATGAGATT CGGAATTGTG GCATAGCTCG AAGAGAGGGG ATTTGGTGGG
AGAGAGGATG AGAGAAGAAG GGAAAGCCAC CACCGCCACA ACTCCTTGAC TCCCTGAGCC GCCGCCACTG CCTTTCACAA
GCTCCAGAGC TGGACCTCTT CTTGCAAAGG GTGTCGATGG ATTCTATGTG TGATAGACAT GGCACTCTTC TTCTCGTGGA
ACTCTTGCTC CTCAGCTTGG TCCTCGTAGA ACCAGTTCAT TTCTAGCAAT TGAGCTTTta ggatcaagat gtcgacttgg
ggtggggggt tgagtaggtg atattaaaaa taaaatagtt gacacctaat caaaactaag ctaaggttgc tagttttggt
gaaggatgaa actaactaag caactagatt aagttttgca attctaggct gataagggtt caagtagtct gtatgagagt
aaattgtatg tatgtaaatg ataagtaaat gagataagag acaaggaatt tttcacccaa gctttggaaa ctcactggtt
tcctaatctc cactaaggcg agcccaactt caccgctcaa accacgaatc ctctaaacca ctacgtcaaa ggatgggcaa
ggtgggagtc ggtcccgaag TAGCTATTGG AGGCAAAAAC CCAACTTACC ACAACCTAAT GGTTATATCG CCAAGGGGAG
GTCGGTCAGA CTAGCCTCGA TTGGACCACC GGTgtgactg ccatagccgt ccgattaggc tgtcggcggc tccaataaga
ccaagctgcc accggttaga ctagtctcgg ctttagcagt tttggatcgc caagagaggg ccaccctacc ggctccatgg
gcgctcagtc tgaccgAGTT CGACCCGATC AAATTGGCAT GCACACCGCA GCCAGACCAG TCGGAGCCCT CGGTAAAACT
GGCGCATAGG GCGTGGTAAG ACCAGCATGT CCTCTTTGGT CAGACTGGCC ATGGTTAGAC AATAGAATAT GATTTCAACC
AAACCAAGTA CCCTCATGCA TCTGAATGAA AAGTTAGATT TATCACTTCA TCCCAATGCT TTGTACCATC ATTTTTATTC
CATGGTAATA ATCCATAACA TGAACATAAT GTGGTCCGTA CTAAaattat caatgcacac aatgaggtcc atactaaaat
tatctcactc caataaaata gttaatccat aattaacatt tatcattaat taccaaaatc aacaTGGTGG TAATTGCACG
ATTTGAAAAA TTAGAGTTAT TGGATACTCA CATTTAGAAT TAGACCCTTT TTTTAAGGAA TTGAATAATG GATTAATATG
ACATGCTCCC TGAGCTAGCG AACAGTACGT GTTTAAAAAA ATCTTTCTGT ATATGAATTT AAAAATATAT TTTAAATTTA
TTTTCCAACT TTATAATAAT CTctccatac aaaaacctaa gacatattat ttttttatca agttcaaaga aaaattaaat
catcttgtat gtaacaaatt aagtatacat gtaactgaat gactgaccgg gttccgctta acaattctaa cactacaaaa
tgaacctcta gatatatgaa gactacaaat acacccatct catttagaga aaaagaaaat aaaatatgtt taaaactttt
ggataaaggg agtaGTTAGT TCATATATTG TACTTTGAAT AATGAACAAA AAAAACAGGC CCTTAGCCGA TAAACTACTT
ATGGTACTTA TCCCGAACTA ATATGGTACT ACTTCGGTCC CGCTATAAGT GTAATTGTAg attcaaattt tatcctaaaa
taggtgcaat tctaccataa tacctaccac atcaatcata tctcatttaa gtttctctct attttaccat caagtaccca
ctcactccct accatcTCCA ATTTAATGGA TGTATTTGGG TAATTTTCTC TCCGTCTTAT TTTCACCTCT CATTGCATGT
TAAAAATGTA CTTACAGTTA TTGATTCACA CATGCAGGGC CTATGTACCA TAACGGTATG TACCATTTGT TCTACCAGTA
CAACCCGCAT AGCGCGCTCT GGGACATCGG CAACCTCTCC TGGGGCCACT CCGTCTCCGG CGACCTCCTC AACTGGGCCG
CTCTCGACAC CGCGCTCGAC CCCACCTCGC CTTTCGACGC CAATGGCTGC TGGTCGGGCT CCGCCACCAT CCTCCCCGGC
GCCCTCCCGG CCATCCTCTA CACCGGCATC GACGCCAGCA AGGAGCAGGT CCAGAACGTC GCCTTCGCCA AGAACCCCTC
CGATCCGCTC CTCCGCGAGT GGGAGAAGCC CGCGTACAAT CCGGTCATCG CGCTCCCGGC CGATGTCCCC GGCGACAAGT
TCCGTGACCC CTCGACGGCA TGGCTCGGCC GTGACGGCCT GTGGCGGATC GCCGTCTCCG CCGAGGTGGA CGGCGTCGCG
TCCACGCTCG TCTACAGGAG CAAGGACTTC GTCCGGTGGG AGCGGAACGC CGCGCCGCTG CACGCGTCGC GCGCCGCGGG
CATGGTGGAG TGCCCGGACC TGTTCCCCGT AGCGGAGCGC GGCGAGGATG GCCTCGACAC GTCGGCGAAC GGCGCCGGCG
GCGTGCGCCA CGTCCTGAAG CTGAGCGTGA TGGACACGCT CCAGGACTAC TACATGGTCG GCACGTACGA CGACGCGGCA
GACGCCTTCT CGCCGGCGGA GCCTGAGCGC GGCGACGACT GCCGGAGCTG GCGGCGGCTG GACTACGGGC ACGTGTACGC
GTCCAAGTCG TTCTTCGACG TGCGCAAGAA CCGGCGCGTT CTGTGGGCGT GGGCGAACGA GTCCGACAGC CAGGCCGACG
ACGTCGCCCG CGGCTGGTCC GGCGTGCAGA CATTCCCGAG GAAGATGTGG CTAGCCAAGG ACGGCAAGCA GCTGCTGCAG
TGGCCGATCG AGGAGATCAA GACGCTGAGG AGGAAGCGCG CCGGTCTCTG GCAAGGCACC AGGCTAGGCG CCGGCGCGGT
GCAGGAGATC GTCGGCGTGG CGAGCTCGCA GGCGGACGTG GAGGTGGTGT TCAAGATTCC GAGCCTGGAG GAGGCCGAGA
GGGTGGACGA CCCCAACCGG CTGCTGGATC CCCAGAAGCT GTGCGGTGAG AAGGGCGCCG CCGTGCGGGG CGGCGTCGGC
CCGTTCGGGC TCCTCGTAAT GGCCTCCGGC GACCTGCACG AGCACACCGC CGTCTTCTTC AGGGTGTTCA GGCACCATGA
CAAGTACAAG CTTCTTATGT GCACCGACTT GACAAAGTAA GAAGGCTAAT AATTTTCCAT TGTTCATCTC TACTAGTATT
AGAACTGACA ACATGTAATT TCAGGTCGTC GACAAGAGCA GGGGTGTACA AGCCGGCTTA CGGCGGATTC GTGGACATGG
ACATCGACGA TCACAAAACC ATATCGCTGA GAACGTTGGT GAGTTCTTCG CAAACATTCA GAGCCACAGA CTTACAGCTT
CAATTGATTC ATCGAACCTT GGTGTTTTTC TTTCTTTTTA TTGGACAGAT TGACCATTCG GTGGTGGAGA GCTTCGGCGG
CGGCGGGCGG GCGTGCATCA CGGCGCGGGT TTACCCGGAG CACGTGGCGA CGAGCAGCAG CCATTTGTAC GTGTTCAACA
ACGGGAGCGA CGCCGTTAAG GTGGCCAAGC TGGAGGCGTG GGACCTGGCG ACGGCGACCG TCAACGTTGT TGTTGGAGAC
CACCACGGCC TTGTTGCGCC GGCGTTGGAG TTGGAGCCGA CACGCACGAC GCAGTGATCT GAGGCCTGAA GCGGCTGGCC
GGCACTGGCA CAGTTGGTTC GATAGTTTGA TGGCATCGTG CAGCCGATTG GTTGTGTGGT GATTTGTTCG ATTGTTGTGA
ACAGGGTGTA TGATCTGTGA CAGAAAGAAG AGCACAAAAG AAATCATTCG ATAGTATACG TCACGTGCTT TATATGTTTT
GC