Os09t0277800-01

Locus

Os09g0277800

Description

Similar to Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplast precursor (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK103141 (DDBJ, Best hit)

Protein Evidence

B6TYG2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Functional domain (InterPro)

Glucose/ribitol dehydrogenase (IPR002347)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J033120G12 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0277800-01)

RiceXPro (AK103141)

Others

KEGG (Os09t0277800-01 (EC:1.3.1.9))

Transcript

1648 bp

>Os09t0277800-01 Similar to Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplast precursor (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase).
CTCAAATCTCCAACTCCAACGAACACACAGAGGGAGGAATCGGATCGGATTGGATCCCAA
CccaccccgcgccgccgctgccgcgtcccgtcccgaatcctccggcgagCCTGACGTCGG
CCGATGGGCGCATCAGTGACTACTGGCTTGCAGATGGCGGCGGCACGCCCTTGTATCCCA
GCTTGCCAACGCCTGCTAGGGTCAAGAGCAGCACTTCCTTCATTTGGAAGGGCGCTTAGT
ACCCAAACTGGCTTCGCGAGCTGCAGAAAAACAGCATCAGCAGGGCCGTTTGTTTCTCTG
AACCACAAGAGGTTTGCCGTGAGGGCGATGTCTGCCCAGGGACTCCCCATTGATCTCAGA
GGTAAAAGAGCATTTATTGCTGGAGTTGCTGATGATAATGGCTATGGCTGGGCAATAGCA
AAAGCTCTTGCTGCAGCTGGTGCCGAGATTCTTGTTGGTACATGGGTACCTGCACTGAAC
ATATTTGAGACAAGCTTGAGGCGTGGGAAGTTTGACGAATCACGAAAGCTTCCTGATGGA
TCTCTTATGGAGATTACAAAAGTCTACCCATTGGATGCAGTTTTTGACTCTCCTGAGGAT
GTTCCTGATGATGTTAAAGCAAACAAAAGGTATGCTGGATCTTCAAACTGGACTGTTAAG
GAAGTTGCTGAAACTGTGAAGAATGACTTTGGTACCATTGACATCCTCGTACACTCTCTT
GCAAATGGTCCTGAGGTAAAAAACTCTTTGCTGGAGACATCAAGAAAAGGGTATCTTGCT
GCAGTTTCAGCATCTAGTTACTCTTTCATCTCTTTACTCCAACACTTCCTTCCTATAATG
AATCCAGGGGGTGCTACTATATCCTTGACCTACATAGCTTCCGAAAGGACAATTCCTGGA
TACGGTGGCGGCATGAGCTCAGCAAAAGCAGCACTTGAGAGTGATACAAGAGTTCTAGCT
TACGAAGCAGGTCGAAAAGGCAAGATCAGAGTGAATACCATATCAGCAGGTCCATTGGGA
AGTCGAGCAGCCAAAGCTATTGGTTTCATCGAGAAGATGATAGAGTATTCGTACGTGAAC
GCACCACTGCAGAAGGAGCTCTTGGCAGATGAAGTGGGGAACACAGCAGCATTCTTAGCA
TCGCCGTTGGCATCTGCAATCACTGGATCAACTATCTATGTTGACAATGGGCTCAATACA
ATGGGACTTGCACTTGACAGCCCTACACTATCCACATAGACGTGTAAACTATTCTCCTGG
ATGGTTCCGTTTGGTAGCAGATGGTCATTAGGCCCCAACTGAAGCTCAAAACCAGATGCT
GATATGAAAATGAGGAAAGATGGTAGTTTGAAGATGCAGACTTTCTAGAAAGTTGAGTTA
CTGGGTTTTCTTCATTTTGGTCTATGCTAGCAATGAGAATTAGCATTGTAGGAGTACAGT
TTGTTGATTGTTCTTATGTTAGTCCTAGCCTCCTAGGATCTGATCTGAAGAAAGAGAATA
ATGGAAGTTAAAAAGAACAGGAAATCGAAGTTCTGCCCATTGCGTTGTTTGTTTTTCGTG
TAGTGTTATCTCTCACTCGGGTTTTATAAAAGTTGTAAAAATCTATAGGTATTATAACGT
GTGGTACATGATCACACAGGTTTTTATT

CDS

1116 bp

>Os09t0277800-01 Similar to Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplast precursor (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase).
ATGGGCGCATCAGTGACTACTGGCTTGCAGATGGCGGCGGCACGCCCTTGTATCCCAGCT
TGCCAACGCCTGCTAGGGTCAAGAGCAGCACTTCCTTCATTTGGAAGGGCGCTTAGTACC
CAAACTGGCTTCGCGAGCTGCAGAAAAACAGCATCAGCAGGGCCGTTTGTTTCTCTGAAC
CACAAGAGGTTTGCCGTGAGGGCGATGTCTGCCCAGGGACTCCCCATTGATCTCAGAGGT
AAAAGAGCATTTATTGCTGGAGTTGCTGATGATAATGGCTATGGCTGGGCAATAGCAAAA
GCTCTTGCTGCAGCTGGTGCCGAGATTCTTGTTGGTACATGGGTACCTGCACTGAACATA
TTTGAGACAAGCTTGAGGCGTGGGAAGTTTGACGAATCACGAAAGCTTCCTGATGGATCT
CTTATGGAGATTACAAAAGTCTACCCATTGGATGCAGTTTTTGACTCTCCTGAGGATGTT
CCTGATGATGTTAAAGCAAACAAAAGGTATGCTGGATCTTCAAACTGGACTGTTAAGGAA
GTTGCTGAAACTGTGAAGAATGACTTTGGTACCATTGACATCCTCGTACACTCTCTTGCA
AATGGTCCTGAGGTAAAAAACTCTTTGCTGGAGACATCAAGAAAAGGGTATCTTGCTGCA
GTTTCAGCATCTAGTTACTCTTTCATCTCTTTACTCCAACACTTCCTTCCTATAATGAAT
CCAGGGGGTGCTACTATATCCTTGACCTACATAGCTTCCGAAAGGACAATTCCTGGATAC
GGTGGCGGCATGAGCTCAGCAAAAGCAGCACTTGAGAGTGATACAAGAGTTCTAGCTTAC
GAAGCAGGTCGAAAAGGCAAGATCAGAGTGAATACCATATCAGCAGGTCCATTGGGAAGT
CGAGCAGCCAAAGCTATTGGTTTCATCGAGAAGATGATAGAGTATTCGTACGTGAACGCA
CCACTGCAGAAGGAGCTCTTGGCAGATGAAGTGGGGAACACAGCAGCATTCTTAGCATCG
CCGTTGGCATCTGCAATCACTGGATCAACTATCTATGTTGACAATGGGCTCAATACAATG
GGACTTGCACTTGACAGCCCTACACTATCCACATAG

Protein

372 aa

>Os09t0277800-01 Similar to Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplast precursor (EC 1.3.1.9) (NADH-dependent enoyl-ACP reductase).
MGASVTTGLQMAAARPCIPACQRLLGSRAALPSFGRALSTQTGFASCRKTASAGPFVSLN
HKRFAVRAMSAQGLPIDLRGKRAFIAGVADDNGYGWAIAKALAAAGAEILVGTWVPALNI
FETSLRRGKFDESRKLPDGSLMEITKVYPLDAVFDSPEDVPDDVKANKRYAGSSNWTVKE
VAETVKNDFGTIDILVHSLANGPEVKNSLLETSRKGYLAAVSASSYSFISLLQHFLPIMN
PGGATISLTYIASERTIPGYGGGMSSAKAALESDTRVLAYEAGRKGKIRVNTISAGPLGS
RAAKAIGFIEKMIEYSYVNAPLQKELLADEVGNTAAFLASPLASAITGSTIYVDNGLNTM
GLALDSPTLST*

5'UTR

chr09:5781847..5781955 (+ strand) : 109 bp

chr09:5782521..5782534 (+ strand) : 14 bp

CDS

chr09:5782535..5782772 (+ strand) : 238 bp

chr09:5783232..5783341 (+ strand) : 110 bp

chr09:5783419..5783474 (+ strand) : 56 bp

chr09:5783584..5783668 (+ strand) : 85 bp

chr09:5783738..5783785 (+ strand) : 48 bp

chr09:5783911..5783985 (+ strand) : 75 bp

chr09:5784081..5784192 (+ strand) : 112 bp

chr09:5784638..5784689 (+ strand) : 52 bp

chr09:5784767..5784818 (+ strand) : 52 bp

chr09:5784917..5784974 (+ strand) : 58 bp

chr09:5785217..5785315 (+ strand) : 99 bp

chr09:5785407..5785537 (+ strand) : 131 bp

3'UTR

chr09:5785538..5785946 (+ strand) : 409 bp

FASTA

>Os09t0277800-01 class=Sequence position=chr09:5781847..5785946 (+ strand)
CTCAAATCTC CAACTCCAAC GAACACACAG AGGGAGGAAT CGGATCGGAT TGGATCCCAA Cccaccccgc gccgccgctg
ccgcgtcccg tcccgaatcc tccggcgagg taaccacctc ctccctgcca ccccctctct ctctacccgc tccgccgccg
tcacctttcg cGCTCGCGAC GAGGGGCCTC TTCCCTGGGG GAGTCAGTGC GGTGCGGAAG CCAATCCGGT GGGGGGGAGT
GTTGGCTGTT CTTGGCTGGC AGAAATGGGG AATCGGGGTT GCGATGCTGC GTCTTGTCAA TGCCTTTGCC GTTAAAGACG
ATGCTTGAGT TTTAGGTTTC ATTTATGATT TTTCTAGGAC ATCAGCCTGA GCAATCGTGA TCTCTGTTTT TTTTAAAAAA
AAAAAGAGGG GGGGGGGGGG CGAATTTTAT GGGAATGCTC CATGCAGCCG AGTTTTCAGT AACTTGTGCA TATACCGAAT
TATTCATGAT TTTCTCTGCA GAAGTGATGG TTTTGCTCCA CTTAACAACT CCAATTTAAG TTTTGTTGTA CGGCATTTTG
CTGACATTGA CCCGTAACTG TCAAAATTAT CGGAAACAGA ATAGATTGAT GCCCCCATGC TCTATCAATA TACATGTTGT
ATTTGACATT ATGCTCGGCT TAATCTCATT GCAGCCTGAC GTCGGCCGAT GGGCGCATCA GTGACTACTG GCTTGCAGAT
GGCGGCGGCA CGCCCTTGTA TCCCAGCTTG CCAACGCCTG CTAGGGTCAA GAGCAGCACT TCCTTCATTT GGAAGGGCGC
TTAGTACCCA AACTGGCTTC GCGAGCTGCA GAAAAACAGC ATCAGCAGGG CCGTTTGTTT CTCTGAACCA CAAGAGGTTT
GCCGTGAGGG CGATGTCTGC CCAGGGACTC CCCATTGATC TCAGAGGTAA GCTTTATGCC TCTCAGTCAA AACTCAACAA
AAAAAAAGTT CTTTAACTCA ATTTTGGAGC TATAATATCT AGACAAGATT TTGAATGGTG TTTATTTTCG TCACTCATCA
TGGCTAAAAA CATTTTAGTG GTGGTCACTA ATTTCTGTAA GTGCTGTATT TTAGTATGTT AATGGGCTTC TAAGATGTAT
GCCATAAAAT GGACTACCTT GATGCATTAT TGAATTATCT GTTATAAGTC TGTTATTAAT TATATGTAAA CTTTTTACTA
CTATTAAACA TGAGTGAACA TGGTTAACTC TTTTGGTATT GCCCTTCTAT ATTTGAGTGA TGCACTGACT CCTCGCACGC
ATAAAAAGTG CTACTAACTT GTCATTACTG AAGGAAATGT ATAATCTAGC ACAACCCAAA GGATATTTAA TCATGAAGTC
TCTAACTTGT TGCATTTTTT TACAGGTAAA AGAGCATTTA TTGCTGGAGT TGCTGATGAT AATGGCTATG GCTGGGCAAT
AGCAAAAGCT CTTGCTGCAG CTGGTGCCGA GATTCTTGTT GGTACATGGG TACCTGTAAG TTGATCTCAT TCACGAAGTG
TATCATTATA GATGTTCTGG TGGAAACACT TAATTCTCAT TCTCATCTTC AGGCACTGAA CATATTTGAG ACAAGCTTGA
GGCGTGGGAA GTTTGACGAA TCACGAAAGT GTGTTCCTAA GTGTACTTGC AGTTATTTAA TGTTTTGTGT AGTCCATTTC
AGTGTTCCAT GCTGGAATGA TTATCATCTC CATGGTGTCT GACTACCTTT GTTGCAGGCT TCCTGATGGA TCTCTTATGG
AGATTACAAA AGTCTACCCA TTGGATGCAG TTTTTGACTC TCCTGAGGAT GTTCCTGATG ATGTAATGTT CATCATTTTC
TTTTTTCATG TCAACTCCTG TTCTGTATTC TGAATCGGTC CTCTGGTGTA GGTTAAAGCA AACAAAAGGT ATGCTGGATC
TTCAAACTGG ACTGTTAAGG TAAGCTGCAG TATGCCTTTT TTGCCATATT ACTTGGAAAT AGATACTTGT GAACCATGAG
GATTACTAAT TTGTACGATC CTCCCAAGTT CCAACCCAAG GCCTAATCTG TCTTTATTTC ATAGGAAGTT GCTGAAACTG
TGAAGAATGA CTTTGGTACC ATTGACATCC TCGTACACTC TCTTGCAAAT GGTCCTGAGG TATGCCACTA TCTTTCTCTT
TCTTTATCTC ATTGTCGTCA TCTGATTATC CTCGTCATCA CTAACATCTA TTTTTTTTTA TTTTCTGCTC AAAGGTAAAA
AACTCTTTGC TGGAGACATC AAGAAAAGGG TATCTTGCTG CAGTTTCAGC ATCTAGTTAC TCTTTCATCT CTTTACTCCA
ACACTTCCTT CCTATAATGA ATCCAGGTAT CAAACAATCT TTGCTAGTGC TCTGTAACTA TTATTATTTT CTCTTTCTGT
TCAGGTGTGG ATTTTTAAAA ATCATGCTAC TTTCTCAATT TATTTGGCCA GTTTTTCATA CTACTAGTTG TATTGTATAA
CAGTACTTAT TTAATGCCAA CTCATTGGTT GCGAGTTGGG CCTTGGCTTT ATCCAAGAAA TTACTTGCTA CCAATCCTTA
ATATCGTCAG ATGGAAAATA ATTAGCGTAC TGCTGGTTAT TAACTCCTGG CTAACTTGTT TGCCATGTGG TTAGGTGTGG
AAACTGTGAC TGGCAATCGA ACAAGCCCTA TGGGCCTTTC TCATGTTTCT TAGATTATTT TGTTCTATTT AGTTAGGTCG
GAATCTAGTT GTTCTAGTTC AAGAGTCATT GCCATTTCAG CATGCTTCAC AGGAATGTCA CTGATTTGCA GGGGGTGCTA
CTATATCCTT GACCTACATA GCTTCCGAAA GGACAATTCC TGGGTGAATA CTCTCTCAAT GTTTATCACT TCTAAATTGT
GAGTATTGTT ACTTATATTT TGTTTTTATT GCTTTTATAG ATACGGTGGC GGCATGAGCT CAGCAAAAGC AGCACTTGAG
AGTGATACAA GAGTATGAAC TTATGTGTGA AGTCGTGCAT ATTTTTTTAA GATCCCAAAT AATGCTTGGT TTGCAAATAT
TTACTTCTGG CCATTCTCTT ATACTTGTAG GTTCTAGCTT ACGAAGCAGG TCGAAAAGGC AAGATCAGAG TGAATACCAT
ATCAGCAGGT ATCTTACAGT AATTAATCTT CTTTTCATAA GAATAAAGTC TCATATAAAT TAATCATTTA TGTGTCAACA
TTCACGCAGC AATAAGTTCA ATCCCAGATG TGTACAATCC TTTTATATGA TAATACAATT TCATTTGCAC TTGCATCCTA
CATAATATTT CATTATTCAA TGTACGGGTT TTGAGGACAT CTGTTCTAAA CTACTTGGCG ACATTACATT CCCATATCCT
GTTTCTGCAG GTCCATTGGG AAGTCGAGCA GCCAAAGCTA TTGGTTTCAT CGAGAAGATG ATAGAGTATT CGTACGTGAA
CGCACCACTG CAGAAGGAGC TCTTGGCAGG TCGAAATTAA CTTCTTTCAG TTTGCCTCTA TTGGGATGCC TATTTATGCA
CCAAAGGTCA CTTATAAAGC TTTATTTATA TGTTCAACAG ATGAAGTGGG GAACACAGCA GCATTCTTAG CATCGCCGTT
GGCATCTGCA ATCACTGGAT CAACTATCTA TGTTGACAAT GGGCTCAATA CAATGGGACT TGCACTTGAC AGCCCTACAC
TATCCACATA GACGTGTAAA CTATTCTCCT GGATGGTTCC GTTTGGTAGC AGATGGTCAT TAGGCCCCAA CTGAAGCTCA
AAACCAGATG CTGATATGAA AATGAGGAAA GATGGTAGTT TGAAGATGCA GACTTTCTAG AAAGTTGAGT TACTGGGTTT
TCTTCATTTT GGTCTATGCT AGCAATGAGA ATTAGCATTG TAGGAGTACA GTTTGTTGAT TGTTCTTATG TTAGTCCTAG
CCTCCTAGGA TCTGATCTGA AGAAAGAGAA TAATGGAAGT TAAAAAGAAC AGGAAATCGA AGTTCTGCCC ATTGCGTTGT
TTGTTTTTCG TGTAGTGTTA TCTCTCACTC GGGTTTTATA AAAGTTGTAA AAATCTATAG GTATTATAAC GTGTGGTACA
TGATCACACA GGTTTTTATT