Os09t0293500-01

Locus

Os09g0293500

Description

BR receptor kinase, Brassinosteroid (BR) perception in the root

RAP-DB Gene Symbol Synonym(s)

BRL1, OsBRL1

RAP-DB Gene Name Synonym(s)

BRI1 LIKE 1, BRI1-like receptor kinase 1

CGSNL Gene Symbol

BRL1

CGSNL Gene Name

BRI1 LIKE 1

Oryzabase Gene Symbol Synonym(s)

OsBRL1

Oryzabase Gene Name Synonym(s)

BRI1-like receptor kinase 1

Transcript Evidence

AK243262

Protein Evidence

Q69JN6

Literature

PMID: 16407447

Note

Manual Curation

November 16, 2009

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Leucine-rich repeat-containing N-terminal, type 2 (IPR013210)

Concanavalin A-like lectin/glucanase domain (IPR013320)

Protein kinase-like domain (IPR011009)

Protein kinase domain (IPR000719)

Serine/threonine/dual specificity protein kinase, catalytic domain (IPR002290)

Leucine-rich repeat, typical subtype (IPR003591)

Leucine-rich repeat (IPR001611)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J100049C05 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0293500-01)

Others

Oryzabase (7386)

KEGG (Os09t0293500-01)

Transcript

4284 bp

>Os09t0293500-01 BR receptor kinase, Brassinosteroid (BR) perception in the root
CTGCTTTTGTACTAGTAGTAGTAGTAATCTGCTTCTCTCTTCTTCATCTTCTTCTCTTGT
CTTCCCTTTTCTTCTAGTCTATCCTCGTTGGCTCAGTTCTTGGAGAGGTTTTTTGTTCGA
GTTGTGTGAGAGAGAATTCGTCCATTCTTGATGAGGTTTTGGGTTCTTGGGCACTTCTTG
TTCTAGCCAAGAGAAATTGCGATTTGAATACGCTCCATCGATATGTGAAGCCATCCAAGA
ACTCGGTGGAAATCAAGAATTCAGAGGCCATCTCGAACGAGCTCACCATCTGCTTGCAAG
AATCAGCGAGTGCGAAGTTGACGTAGACGACGAGAAGCCATGGCCGCCTCGCCGCCGTTC
ATGGCGGCCGCGGCGTTCCTTACGCTTGTGGTGGTGCTGTTTCGGGCgccggctcccgcc
attgccgtcggcgaggaggcggcggcgctgctggccttcaggcgcgcgtccgtggcggac
gacccggacggcgcgctggcgagctgggtgctgggcgccggcggcgccaactccaccgcg
ccgtgctcgtgggacggcgtgtcgtgcgcgccgccgcccgacggccgcgtcgccgccgtc
gacctcagcggcatgagcctcgccggcgagctgcggctcgacgcgctcctcgcgctcccg
gcgctgcagcgcctcaatctccgcggcaatgccttctacggcaacctctcgcacgccgcg
ccgtcgccgccgtgcgcgctcGTGGAGGTGGACATCTCGTCGAACGCCTTGAACGGGACG
CTGCCGCCGTCGTTCCTGGCGCCGTGCGGCGTGCTGCGGTCCGTGAACCTGTCGAGGAAC
GGCCTCGCCGGCGGCGGGTTCCCGTTCGCGCCGTCGCTGCGGTCGCTGGACCTGTCGCGC
AACCGCCTCGCCGACGCCGGCCTGCTCAACTACTCCTTCGCCGGCTGCCACGGCGTCGGC
TACCTCAACCTCTCCGCCAACCTCTTCGCCGGGCGGCTGCCGGAGCTCGCCGCGTGCAGC
GCGGTGACCACGCTCGACGTGTCGTGGAACCACATGTCCGGCGGGCTCCCGCCGGGGCTC
GTGGCCACCGCGCCGGCCAACCTGACGTACCTCAACATCGCCGGCAACAACTTCACCGGC
GATGTCTCCGGCTACGACTTCGGCGGGTGCGCCAACCTCACGGTGCTCGACTGGTCCTAC
AATGGCCTAAGTAGCACCAGGTTGCCACCGGGGCTCATCAACTGCCGCCGCCTCGAGACG
CTGGAGATGTCCGGGAACAAGCTCCTCTCTGGCGCGCTGCCGACATTCTTGGTCGGCTTC
TCGTCGCTGAGGCGGCTGGCATTGGCCGGCAACGAGTTCACCGGAGCGATTCCGGTGGAG
CTGGGGCAATTGTGTGGCAGAATTGTTGAGCTGGACTTATCCAGCAACCGGCTGGTTGGT
GCCTTGCCGGCGAGCTTTGCAAAGTGCAAGTCTCTTGAGGTGCTCGACCTCGGTGGCAAC
CAGCTCGCCGGCGACTTTGTGGCCAGTGTCGTCAGCACCATCGCCTCGCTGCGTGAGCTG
CGGCTGTCGTTCAACAACATCACCGGTGTAAACCCGCTGCCGGTGCTCGCAGCGGGGTGT
CCATTGCTGGAGGTGATTGATCTTGGGTCCAATGAGCTCGATGGGGAGATAATGCCGGAT
CTTTGCTCGTCGTTGCCATCATTGCGGAAGCTGCTCCTTCCGAACAATTACCTCAATGGC
ACCGTGCCGCCTTCGCTTGGCGATTGCGCCAATCTGGAGTCCATTGATCTCAGCTTCAAT
CTGCTGGTTGGCAAGATCCCAACAGAGATAATCAGGCTTCCGAAGATCGTTGATCTGGTC
ATGTGGGCGAATGGCCTATCCGGTGAGATACCGGATGTTCTCTGCTCCAATGGCACCACA
TTGGAGACATTGGTGATAAGCTACAACAACTTCACCGGAAGCATTCCAAGATCCATTACA
AAGTGTGTGAATCTCATCTGGGTGTCGCTTTCCGGTAACCGTCTTACCGGGAGCGTGCCC
GGTGGATTCGGCAAGCTTCAGAAGCTTGCCATTCTGCAACTCAACAAGAATCTGCTATCT
GGACATGTTCCAGCAGAGCTTGGCAGCTGCAACAACCTCATCTGGCTTGATCTCAACAGC
AACAGCTTCACCGGGACGATACCGCCGCAGTTGGCAGGCCAGGCAGGGCTTGTTCCGGGA
GGTATTGTGTCAGGAAAGCAGTTTGCATTTCTCCGGAATGAGGCTGGCAACATATGCCCT
GGTGCCGGTGTTCTCTTTGAGTTCTTTGGCATCAGGCCAGAGCGGTTGGCTGAGTTCCCT
GCAGTGCATCTGTGCCCATCCACAAGGATTTACACGGGCACGACGGTTTATACATTCACC
AACAATGGGAGTATGATCTTCCTTGATCTCTCATACAATGGCCTCACCGGCACAATCCCA
GGAAGTCTTGGAAACATGATGTATCTTCAGGTCCTTAACTTGGGGCACAATGAGCTCAAT
GGTACAATACCGGATGCATTTCAGAACCTCAAGTCGATCGGCGCACTCGATCTCTCAAAC
AATCAGCTCAGTGGTGGCATTCCTCCAGGCCTTGGTGGTTTGAATTTCCTTGCAGATTTT
GATGTCTCCAACAACAACCTGACTGGTCCAATCCCTTCATCCGGGCAGCTCACCACGTTC
CCGCCATCCCGGTACGACAACAACAATGGTCTCTGTGGCATCCCTTTGCCTCCTTGTGGC
CACAATCCCCCATGGGGAGGTAGGCCACGCGGTTCGCCTGATGGGAAGAGGAAGGTGATT
GGGGCGAGCATTCTTGTCGGGGTGGCACTCTCCGTGCTCATACTGCTCCTGCTGCTGGTC
ACTCTCTGCAAGCTCAGGATGAACCAGAAGACTGAAGAGGTGAGAACTGGGTATGTTGAG
AGCCTTCCAACATCTGGAACATCGAGTTGGAAGCTGTCGGGTGTCCGTGAGCCGCTAAGC
ATCAATGTGGCGACATTCGAGAAGCCGCTGAGGAAGCTCACATTTGCACACCTCCTTGAG
GCCACCAATGGATTCAGTGCTGAGACTCTCATTGGATCAGGGGGATTTGGTGAGGTATAC
AAGGCCAAGCTCAAGGATGGCAGTGTTGTGGCCATCAAGAAACTGATTCACTTCACTGGC
CAAGGTGACCGGGAATTCACTGCAGAGATGGAGACCATTGGAAAGATCAAGCACCGCAAC
CTTGTCCCATTGCTTGGATATTGCAAGATTGGTGATGAGAGGCTCCTTGTCTACGAGTAC
ATGAAACACGGCAGCCTGGATGTTGTGCTCCATGACAAGGCCAAGGCTAGTGTGAAGCTT
GACTGGTCAGCAAGAAAGAAAATTGCAATTGGTTCAGCCAGGGGCCTCGCATTCCTCCAC
CACAGCTGCATCCCACACATCATACACCGGGACATGAAGTCGAGCAATGTGCTTCTTGAC
AACAACCTCGATGCCCGTGTATCGGATTTCGGGATGGCAAGGCTGATGAATGCGCTTGAT
ACGCATCTGAGTGTGAGCACACTTGCaggtacacctgggtatgtgccacctgagtactac
caaagcttcaggtgcacgaccaaaggcgacgtctacagctatggtgttgtgctcttggaG
CTCCTCTCAGGTAAGAAGCCAATTGATCCGACTGAGTTTGGAGACAACAACCTTGTTGGT
TGGGTGAAGCAGATGGTTAAAGAGAACAGAAGCAGTGAGATCTTTGATCCTACATTGACT
GATAGAAAATCAGGGGAAGCAGAGCTCTATCAGTACCTGAAGATTGCATGCGAGTGCTTG
GATGATCGACCCAACCGAAGGCCAACCATGATTCAGGTCATGGCAATGTTCAAAGAGCTG
CAGCTTGACTCGGACAGTGATATCCTCGATGGCTTTTCGATCAATTCGTCAACTATAGAT
GAGTCAGGAGAGAAATCAATGTAATGCTGTCTAGTTCTTGCAGATTTTGATTATCCGAAG
TGGTAAAATATCAGACTAGCTCAACCATTTTGGCTCCATGGTAGAAAAAAAGGTAGTATC
CTCCAATTCAGTAGGAAAAGTTGTAATTTTGGTTCAAATCACTGTACATAATACATCAAA
GTATGAAGGAGAACACGGTGGTAGGATTTAATTTCAGAAAAAAAAGGCAGTTCTCTTTAC
CTGGAGAGACTAGTATGTACCAATCAAATTTCTTGCTTTTGAGCATCAATATTGTCAAGA
ATGTAATACATATTAGCTTTCCTT

CDS

3645 bp

>Os09t0293500-01 BR receptor kinase, Brassinosteroid (BR) perception in the root
ATGGCCGCCTCGCCGCCGTTCATGGCGGCCGCGGCGTTCCTTACGCTTGTGGTGGTGCTG
TTTCGGGCgccggctcccgccattgccgtcggcgaggaggcggcggcgctgctggccttc
aggcgcgcgtccgtggcggacgacccggacggcgcgctggcgagctgggtgctgggcgcc
ggcggcgccaactccaccgcgccgtgctcgtgggacggcgtgtcgtgcgcgccgccgccc
gacggccgcgtcgccgccgtcgacctcagcggcatgagcctcgccggcgagctgcggctc
gacgcgctcctcgcgctcccggcgctgcagcgcctcaatctccgcggcaatgccttctac
ggcaacctctcgcacgccgcgccgtcgccgccgtgcgcgctcGTGGAGGTGGACATCTCG
TCGAACGCCTTGAACGGGACGCTGCCGCCGTCGTTCCTGGCGCCGTGCGGCGTGCTGCGG
TCCGTGAACCTGTCGAGGAACGGCCTCGCCGGCGGCGGGTTCCCGTTCGCGCCGTCGCTG
CGGTCGCTGGACCTGTCGCGCAACCGCCTCGCCGACGCCGGCCTGCTCAACTACTCCTTC
GCCGGCTGCCACGGCGTCGGCTACCTCAACCTCTCCGCCAACCTCTTCGCCGGGCGGCTG
CCGGAGCTCGCCGCGTGCAGCGCGGTGACCACGCTCGACGTGTCGTGGAACCACATGTCC
GGCGGGCTCCCGCCGGGGCTCGTGGCCACCGCGCCGGCCAACCTGACGTACCTCAACATC
GCCGGCAACAACTTCACCGGCGATGTCTCCGGCTACGACTTCGGCGGGTGCGCCAACCTC
ACGGTGCTCGACTGGTCCTACAATGGCCTAAGTAGCACCAGGTTGCCACCGGGGCTCATC
AACTGCCGCCGCCTCGAGACGCTGGAGATGTCCGGGAACAAGCTCCTCTCTGGCGCGCTG
CCGACATTCTTGGTCGGCTTCTCGTCGCTGAGGCGGCTGGCATTGGCCGGCAACGAGTTC
ACCGGAGCGATTCCGGTGGAGCTGGGGCAATTGTGTGGCAGAATTGTTGAGCTGGACTTA
TCCAGCAACCGGCTGGTTGGTGCCTTGCCGGCGAGCTTTGCAAAGTGCAAGTCTCTTGAG
GTGCTCGACCTCGGTGGCAACCAGCTCGCCGGCGACTTTGTGGCCAGTGTCGTCAGCACC
ATCGCCTCGCTGCGTGAGCTGCGGCTGTCGTTCAACAACATCACCGGTGTAAACCCGCTG
CCGGTGCTCGCAGCGGGGTGTCCATTGCTGGAGGTGATTGATCTTGGGTCCAATGAGCTC
GATGGGGAGATAATGCCGGATCTTTGCTCGTCGTTGCCATCATTGCGGAAGCTGCTCCTT
CCGAACAATTACCTCAATGGCACCGTGCCGCCTTCGCTTGGCGATTGCGCCAATCTGGAG
TCCATTGATCTCAGCTTCAATCTGCTGGTTGGCAAGATCCCAACAGAGATAATCAGGCTT
CCGAAGATCGTTGATCTGGTCATGTGGGCGAATGGCCTATCCGGTGAGATACCGGATGTT
CTCTGCTCCAATGGCACCACATTGGAGACATTGGTGATAAGCTACAACAACTTCACCGGA
AGCATTCCAAGATCCATTACAAAGTGTGTGAATCTCATCTGGGTGTCGCTTTCCGGTAAC
CGTCTTACCGGGAGCGTGCCCGGTGGATTCGGCAAGCTTCAGAAGCTTGCCATTCTGCAA
CTCAACAAGAATCTGCTATCTGGACATGTTCCAGCAGAGCTTGGCAGCTGCAACAACCTC
ATCTGGCTTGATCTCAACAGCAACAGCTTCACCGGGACGATACCGCCGCAGTTGGCAGGC
CAGGCAGGGCTTGTTCCGGGAGGTATTGTGTCAGGAAAGCAGTTTGCATTTCTCCGGAAT
GAGGCTGGCAACATATGCCCTGGTGCCGGTGTTCTCTTTGAGTTCTTTGGCATCAGGCCA
GAGCGGTTGGCTGAGTTCCCTGCAGTGCATCTGTGCCCATCCACAAGGATTTACACGGGC
ACGACGGTTTATACATTCACCAACAATGGGAGTATGATCTTCCTTGATCTCTCATACAAT
GGCCTCACCGGCACAATCCCAGGAAGTCTTGGAAACATGATGTATCTTCAGGTCCTTAAC
TTGGGGCACAATGAGCTCAATGGTACAATACCGGATGCATTTCAGAACCTCAAGTCGATC
GGCGCACTCGATCTCTCAAACAATCAGCTCAGTGGTGGCATTCCTCCAGGCCTTGGTGGT
TTGAATTTCCTTGCAGATTTTGATGTCTCCAACAACAACCTGACTGGTCCAATCCCTTCA
TCCGGGCAGCTCACCACGTTCCCGCCATCCCGGTACGACAACAACAATGGTCTCTGTGGC
ATCCCTTTGCCTCCTTGTGGCCACAATCCCCCATGGGGAGGTAGGCCACGCGGTTCGCCT
GATGGGAAGAGGAAGGTGATTGGGGCGAGCATTCTTGTCGGGGTGGCACTCTCCGTGCTC
ATACTGCTCCTGCTGCTGGTCACTCTCTGCAAGCTCAGGATGAACCAGAAGACTGAAGAG
GTGAGAACTGGGTATGTTGAGAGCCTTCCAACATCTGGAACATCGAGTTGGAAGCTGTCG
GGTGTCCGTGAGCCGCTAAGCATCAATGTGGCGACATTCGAGAAGCCGCTGAGGAAGCTC
ACATTTGCACACCTCCTTGAGGCCACCAATGGATTCAGTGCTGAGACTCTCATTGGATCA
GGGGGATTTGGTGAGGTATACAAGGCCAAGCTCAAGGATGGCAGTGTTGTGGCCATCAAG
AAACTGATTCACTTCACTGGCCAAGGTGACCGGGAATTCACTGCAGAGATGGAGACCATT
GGAAAGATCAAGCACCGCAACCTTGTCCCATTGCTTGGATATTGCAAGATTGGTGATGAG
AGGCTCCTTGTCTACGAGTACATGAAACACGGCAGCCTGGATGTTGTGCTCCATGACAAG
GCCAAGGCTAGTGTGAAGCTTGACTGGTCAGCAAGAAAGAAAATTGCAATTGGTTCAGCC
AGGGGCCTCGCATTCCTCCACCACAGCTGCATCCCACACATCATACACCGGGACATGAAG
TCGAGCAATGTGCTTCTTGACAACAACCTCGATGCCCGTGTATCGGATTTCGGGATGGCA
AGGCTGATGAATGCGCTTGATACGCATCTGAGTGTGAGCACACTTGCaggtacacctggg
tatgtgccacctgagtactaccaaagcttcaggtgcacgaccaaaggcgacgtctacagc
tatggtgttgtgctcttggaGCTCCTCTCAGGTAAGAAGCCAATTGATCCGACTGAGTTT
GGAGACAACAACCTTGTTGGTTGGGTGAAGCAGATGGTTAAAGAGAACAGAAGCAGTGAG
ATCTTTGATCCTACATTGACTGATAGAAAATCAGGGGAAGCAGAGCTCTATCAGTACCTG
AAGATTGCATGCGAGTGCTTGGATGATCGACCCAACCGAAGGCCAACCATGATTCAGGTC
ATGGCAATGTTCAAAGAGCTGCAGCTTGACTCGGACAGTGATATCCTCGATGGCTTTTCG
ATCAATTCGTCAACTATAGATGAGTCAGGAGAGAAATCAATGTAA

Protein

1215 aa

>Os09t0293500-01 BR receptor kinase, Brassinosteroid (BR) perception in the root
MAASPPFMAAAAFLTLVVVLFRAPAPAIAVGEEAAALLAFRRASVADDPDGALASWVLGA
GGANSTAPCSWDGVSCAPPPDGRVAAVDLSGMSLAGELRLDALLALPALQRLNLRGNAFY
GNLSHAAPSPPCALVEVDISSNALNGTLPPSFLAPCGVLRSVNLSRNGLAGGGFPFAPSL
RSLDLSRNRLADAGLLNYSFAGCHGVGYLNLSANLFAGRLPELAACSAVTTLDVSWNHMS
GGLPPGLVATAPANLTYLNIAGNNFTGDVSGYDFGGCANLTVLDWSYNGLSSTRLPPGLI
NCRRLETLEMSGNKLLSGALPTFLVGFSSLRRLALAGNEFTGAIPVELGQLCGRIVELDL
SSNRLVGALPASFAKCKSLEVLDLGGNQLAGDFVASVVSTIASLRELRLSFNNITGVNPL
PVLAAGCPLLEVIDLGSNELDGEIMPDLCSSLPSLRKLLLPNNYLNGTVPPSLGDCANLE
SIDLSFNLLVGKIPTEIIRLPKIVDLVMWANGLSGEIPDVLCSNGTTLETLVISYNNFTG
SIPRSITKCVNLIWVSLSGNRLTGSVPGGFGKLQKLAILQLNKNLLSGHVPAELGSCNNL
IWLDLNSNSFTGTIPPQLAGQAGLVPGGIVSGKQFAFLRNEAGNICPGAGVLFEFFGIRP
ERLAEFPAVHLCPSTRIYTGTTVYTFTNNGSMIFLDLSYNGLTGTIPGSLGNMMYLQVLN
LGHNELNGTIPDAFQNLKSIGALDLSNNQLSGGIPPGLGGLNFLADFDVSNNNLTGPIPS
SGQLTTFPPSRYDNNNGLCGIPLPPCGHNPPWGGRPRGSPDGKRKVIGASILVGVALSVL
ILLLLLVTLCKLRMNQKTEEVRTGYVESLPTSGTSSWKLSGVREPLSINVATFEKPLRKL
TFAHLLEATNGFSAETLIGSGGFGEVYKAKLKDGSVVAIKKLIHFTGQGDREFTAEMETI
GKIKHRNLVPLLGYCKIGDERLLVYEYMKHGSLDVVLHDKAKASVKLDWSARKKIAIGSA
RGLAFLHHSCIPHIIHRDMKSSNVLLDNNLDARVSDFGMARLMNALDTHLSVSTLAGTPG
YVPPEYYQSFRCTTKGDVYSYGVVLLELLSGKKPIDPTEFGDNNLVGWVKQMVKENRSSE
IFDPTLTDRKSGEAELYQYLKIACECLDDRPNRRPTMIQVMAMFKELQLDSDSDILDGFS
INSSTIDESGEKSM*

5'UTR

chr09:6959477..6959667 (- strand) : 191 bp

chr09:6958912..6959059 (- strand) : 148 bp

CDS

chr09:6955267..6958911 (- strand) : 3645 bp

3'UTR

chr09:6954967..6955266 (- strand) : 300 bp

FASTA

>Os09t0293500-01 class=Sequence position=chr09:6954967..6959667 (- strand)
CTGCTTTTGT ACTAGTAGTA GTAGTAATCT GCTTCTCTCT TCTTCATCTT CTTCTCTTGT CTTCCCTTTT CTTCTAGTCT
ATCCTCGTTG GCTCAGTTCT TGGAGAGGTT TTTTGTTCGA GTTGTGTGAG AGAGAATTCG TCCATTCTTG ATGAGGTTTT
GGGTTCTTGG GCACTTCTTG TTCTAGCCAA GGTGAGAGGT TAAGGTTAAT TCTTCTTTAG ATGGAGCTTT TTGAAAATGT
TTGGTTGTTT TGTTGGTGGT TTGTTTGGGT TTCTTGATGG TTTTGTGGCT TCTTTTGTTC TTGGAGAAAT ATGTAAGGGG
TTGGGTTCTT TTGGATTTTA TTTGGGGTAC GAATAATTGA AGTTCGTTTC TGTGCTAATT TGGTTCGTGG GTTGTATCTA
TCAATTGTCT TGATTTTGAG GGATTAATGT GTAGTTTGTG CGAGGAATTT TGATTTTGGT TCAAACTGTT GTTGTTGGGC
GCTTTCCCTT GCAAAGATTC CTTGTGTTTC TTCCTTTTGG GTGTTTTGAG TCGATTCATG CCGCGAATTT GGGTTGAATT
TGTTTGCCAC AATGACGCGG AAGTGAAATT TTGAATTGAT TTTTGCAGAG AAATTGCGAT TTGAATACGC TCCATCGATA
TGTGAAGCCA TCCAAGAACT CGGTGGAAAT CAAGAATTCA GAGGCCATCT CGAACGAGCT CACCATCTGC TTGCAAGAAT
CAGCGAGTGC GAAGTTGACG TAGACGACGA GAAGCCATGG CCGCCTCGCC GCCGTTCATG GCGGCCGCGG CGTTCCTTAC
GCTTGTGGTG GTGCTGTTTC GGGCgccggc tcccgccatt gccgtcggcg aggaggcggc ggcgctgctg gccttcaggc
gcgcgtccgt ggcggacgac ccggacggcg cgctggcgag ctgggtgctg ggcgccggcg gcgccaactc caccgcgccg
tgctcgtggg acggcgtgtc gtgcgcgccg ccgcccgacg gccgcgtcgc cgccgtcgac ctcagcggca tgagcctcgc
cggcgagctg cggctcgacg cgctcctcgc gctcccggcg ctgcagcgcc tcaatctccg cggcaatgcc ttctacggca
acctctcgca cgccgcgccg tcgccgccgt gcgcgctcGT GGAGGTGGAC ATCTCGTCGA ACGCCTTGAA CGGGACGCTG
CCGCCGTCGT TCCTGGCGCC GTGCGGCGTG CTGCGGTCCG TGAACCTGTC GAGGAACGGC CTCGCCGGCG GCGGGTTCCC
GTTCGCGCCG TCGCTGCGGT CGCTGGACCT GTCGCGCAAC CGCCTCGCCG ACGCCGGCCT GCTCAACTAC TCCTTCGCCG
GCTGCCACGG CGTCGGCTAC CTCAACCTCT CCGCCAACCT CTTCGCCGGG CGGCTGCCGG AGCTCGCCGC GTGCAGCGCG
GTGACCACGC TCGACGTGTC GTGGAACCAC ATGTCCGGCG GGCTCCCGCC GGGGCTCGTG GCCACCGCGC CGGCCAACCT
GACGTACCTC AACATCGCCG GCAACAACTT CACCGGCGAT GTCTCCGGCT ACGACTTCGG CGGGTGCGCC AACCTCACGG
TGCTCGACTG GTCCTACAAT GGCCTAAGTA GCACCAGGTT GCCACCGGGG CTCATCAACT GCCGCCGCCT CGAGACGCTG
GAGATGTCCG GGAACAAGCT CCTCTCTGGC GCGCTGCCGA CATTCTTGGT CGGCTTCTCG TCGCTGAGGC GGCTGGCATT
GGCCGGCAAC GAGTTCACCG GAGCGATTCC GGTGGAGCTG GGGCAATTGT GTGGCAGAAT TGTTGAGCTG GACTTATCCA
GCAACCGGCT GGTTGGTGCC TTGCCGGCGA GCTTTGCAAA GTGCAAGTCT CTTGAGGTGC TCGACCTCGG TGGCAACCAG
CTCGCCGGCG ACTTTGTGGC CAGTGTCGTC AGCACCATCG CCTCGCTGCG TGAGCTGCGG CTGTCGTTCA ACAACATCAC
CGGTGTAAAC CCGCTGCCGG TGCTCGCAGC GGGGTGTCCA TTGCTGGAGG TGATTGATCT TGGGTCCAAT GAGCTCGATG
GGGAGATAAT GCCGGATCTT TGCTCGTCGT TGCCATCATT GCGGAAGCTG CTCCTTCCGA ACAATTACCT CAATGGCACC
GTGCCGCCTT CGCTTGGCGA TTGCGCCAAT CTGGAGTCCA TTGATCTCAG CTTCAATCTG CTGGTTGGCA AGATCCCAAC
AGAGATAATC AGGCTTCCGA AGATCGTTGA TCTGGTCATG TGGGCGAATG GCCTATCCGG TGAGATACCG GATGTTCTCT
GCTCCAATGG CACCACATTG GAGACATTGG TGATAAGCTA CAACAACTTC ACCGGAAGCA TTCCAAGATC CATTACAAAG
TGTGTGAATC TCATCTGGGT GTCGCTTTCC GGTAACCGTC TTACCGGGAG CGTGCCCGGT GGATTCGGCA AGCTTCAGAA
GCTTGCCATT CTGCAACTCA ACAAGAATCT GCTATCTGGA CATGTTCCAG CAGAGCTTGG CAGCTGCAAC AACCTCATCT
GGCTTGATCT CAACAGCAAC AGCTTCACCG GGACGATACC GCCGCAGTTG GCAGGCCAGG CAGGGCTTGT TCCGGGAGGT
ATTGTGTCAG GAAAGCAGTT TGCATTTCTC CGGAATGAGG CTGGCAACAT ATGCCCTGGT GCCGGTGTTC TCTTTGAGTT
CTTTGGCATC AGGCCAGAGC GGTTGGCTGA GTTCCCTGCA GTGCATCTGT GCCCATCCAC AAGGATTTAC ACGGGCACGA
CGGTTTATAC ATTCACCAAC AATGGGAGTA TGATCTTCCT TGATCTCTCA TACAATGGCC TCACCGGCAC AATCCCAGGA
AGTCTTGGAA ACATGATGTA TCTTCAGGTC CTTAACTTGG GGCACAATGA GCTCAATGGT ACAATACCGG ATGCATTTCA
GAACCTCAAG TCGATCGGCG CACTCGATCT CTCAAACAAT CAGCTCAGTG GTGGCATTCC TCCAGGCCTT GGTGGTTTGA
ATTTCCTTGC AGATTTTGAT GTCTCCAACA ACAACCTGAC TGGTCCAATC CCTTCATCCG GGCAGCTCAC CACGTTCCCG
CCATCCCGGT ACGACAACAA CAATGGTCTC TGTGGCATCC CTTTGCCTCC TTGTGGCCAC AATCCCCCAT GGGGAGGTAG
GCCACGCGGT TCGCCTGATG GGAAGAGGAA GGTGATTGGG GCGAGCATTC TTGTCGGGGT GGCACTCTCC GTGCTCATAC
TGCTCCTGCT GCTGGTCACT CTCTGCAAGC TCAGGATGAA CCAGAAGACT GAAGAGGTGA GAACTGGGTA TGTTGAGAGC
CTTCCAACAT CTGGAACATC GAGTTGGAAG CTGTCGGGTG TCCGTGAGCC GCTAAGCATC AATGTGGCGA CATTCGAGAA
GCCGCTGAGG AAGCTCACAT TTGCACACCT CCTTGAGGCC ACCAATGGAT TCAGTGCTGA GACTCTCATT GGATCAGGGG
GATTTGGTGA GGTATACAAG GCCAAGCTCA AGGATGGCAG TGTTGTGGCC ATCAAGAAAC TGATTCACTT CACTGGCCAA
GGTGACCGGG AATTCACTGC AGAGATGGAG ACCATTGGAA AGATCAAGCA CCGCAACCTT GTCCCATTGC TTGGATATTG
CAAGATTGGT GATGAGAGGC TCCTTGTCTA CGAGTACATG AAACACGGCA GCCTGGATGT TGTGCTCCAT GACAAGGCCA
AGGCTAGTGT GAAGCTTGAC TGGTCAGCAA GAAAGAAAAT TGCAATTGGT TCAGCCAGGG GCCTCGCATT CCTCCACCAC
AGCTGCATCC CACACATCAT ACACCGGGAC ATGAAGTCGA GCAATGTGCT TCTTGACAAC AACCTCGATG CCCGTGTATC
GGATTTCGGG ATGGCAAGGC TGATGAATGC GCTTGATACG CATCTGAGTG TGAGCACACT TGCaggtaca cctgggtatg
tgccacctga gtactaccaa agcttcaggt gcacgaccaa aggcgacgtc tacagctatg gtgttgtgct cttggaGCTC
CTCTCAGGTA AGAAGCCAAT TGATCCGACT GAGTTTGGAG ACAACAACCT TGTTGGTTGG GTGAAGCAGA TGGTTAAAGA
GAACAGAAGC AGTGAGATCT TTGATCCTAC ATTGACTGAT AGAAAATCAG GGGAAGCAGA GCTCTATCAG TACCTGAAGA
TTGCATGCGA GTGCTTGGAT GATCGACCCA ACCGAAGGCC AACCATGATT CAGGTCATGG CAATGTTCAA AGAGCTGCAG
CTTGACTCGG ACAGTGATAT CCTCGATGGC TTTTCGATCA ATTCGTCAAC TATAGATGAG TCAGGAGAGA AATCAATGTA
ATGCTGTCTA GTTCTTGCAG ATTTTGATTA TCCGAAGTGG TAAAATATCA GACTAGCTCA ACCATTTTGG CTCCATGGTA
GAAAAAAAGG TAGTATCCTC CAATTCAGTA GGAAAAGTTG TAATTTTGGT TCAAATCACT GTACATAATA CATCAAAGTA
TGAAGGAGAA CACGGTGGTA GGATTTAATT TCAGAAAAAA AAGGCAGTTC TCTTTACCTG GAGAGACTAG TATGTACCAA
TCAAATTTCT TGCTTTTGAG CATCAATATT GTCAAGAATG TAATACATAT TAGCTTTCCT T

Locus: Os09g0293500

Loading...

Locus: Os09g0293500

Loading...