Os09t0297400-01

Locus

Os09g0297400

Description

Similar to Phosphate/phosphoenolpyruvate translocator.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PPT1

CGSNL Gene Name

PHOSPHOENOLPYRUVATE/PHOSPHATE TRANSLOCATOR 1

Oryzabase Gene Symbol Synonym(s)

OsPPT1

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK071036 (DDBJ, Best hit)

Protein Evidence

Q69VR7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transport (GO:0006810)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: transporter activity (GO:0005215)

Functional domain (InterPro)

Drug/metabolite transporter (IPR000620)

Tpt phosphate/phosphoenolpyruvate translocator (IPR004696)

Domain of unknown function DUF250 (IPR004853)

Full-length cDNA

J023080P10 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0297400-01)

RiceXPro (AK071036)

Others

Oryzabase (8715)

KEGG (Os09t0297400-01)

Transcript

1671 bp

>Os09t0297400-01 Similar to Phosphate/phosphoenolpyruvate translocator.
GCCATCCTCGAGCACTCCGCCGCCGCCGCCGCCGCCGCCTCGACGCATCCGCTTCCCCCC
ACGCGAGCCGAAGCTTCTAGAACCTTCGAGGCCGCGGCTCCCACGGGCGGCAATGCAGAG
CGCGGCGGCCGTCGGGCTCCTCCGGCCATGCGGCGCCACCACCGCCGCCGCCCCGCTCCA
GCTCCGCAACCCTAGCCCCCGGGGCTTCGGCGTCGGAGTCGGGCAGCCGCTGCTCCCGCC
GAGGGGGCTCCGCCTCTCCGCCGTGGCCCCGCGCGCGGGCATCTCCGCCCGGCGCATCGG
GCTCGTGCCGGCCTCCCCGGAGCAGGAGGATGAGCGGCGGCGGGGCGCACGCGACGTGGC
CGTGGCGGCGACAGCGGCGGCGGCGGGTGAGGCAGGGGCGGAGGAGGGTGGAGGGCTCGC
GAAGACGCTGCAGCTCGGCGCGCTCTTCGGGCTGTGGTACCTCTTCAACATCTACTTCAA
CATCTACAACAAGCAGGTTTTGAAGGTTTTTCCATACCCCATAAACATCACAAATGTCCA
GTTTGCTGTCGGCACTGTCATTGCTCTGTTCATGTGGATTACCGGTATCCTTAAAAGACC
AAAGATCTCCGGTGCGCAGCTTGCTGCTATCCTTCCTCTCGCTATGGTCCACACCATGGG
CAATCTTTTCACGAACATGAGCCTTGGAAAGGTTGCAGTGTCATTTACACATACTATCAA
GGCTATGGAGCCTTTCTTTTCAGTTCTGCTTTCAGCACTTTTCCTCGGAGAGATGCCTAC
TCCTTTTGTTGTATTGTCTCTTGTTCCAATTGTTGGTGGTGTGGCATTGGCATCTCTTAC
TGAAGCTTCATTTAACTGGGCTGGATTTTGGAGTGCAATGGCCTCAAATGTCACCTTCCA
GTCAAGGAATGTGTTGAGCAAGAAGCTTATGGTGAAGAAGGAGGAATCTCTGGACAACAT
TACCCTCTTCTCAATCATTACAGTGATGTCATTCTTCCTCTTGGCCCCAGTAACCTTGCT
AACAGAGGGTGTCAAAGTCACTCCGACAGTTCTGCAGTCTGCTGGTCTGAACTTAAAACA
GATATACACAAGGTCACTGATTGCTGCGTTCTGTTTCCATGCATACCAACAGGTGTCGTA
CATGATCCTGGCAAGAGTGTCCCCTGTTACTCACTCGGTGGGTAACTGTGTCAAGCGAGT
GGTGGTCATTGTGACATCCGTTCTGTTCTTCCGCACCCCTGTTTCGCCTATCAACTCTCT
GGGAACCGGAGTCGCTCTTGCCGGAGTTTTCCTGTACTCACAATTGAAGCGGCTTAAACC
CAAGCCCAAGACTGCCTGATTGTGTCTTGGTATCTATCGTGAAGAACCGTAGAAGCATTG
CCACACGCCATCGGAATGAGTGCCTTAGCTTAGAATGATCCTTGGAGAAGCTCCATCCAG
TGAACTGATGCTGCTGTGTGTATCGTTTGTAGTTGAGTTACTAGCGTGCTAATCGTGGCA
AGGTTTTTGTGTCTTCTTTACCACCTTATGCTTGAACAGTCAATTATTTTGTTGTATCAA
TAAATTTCGTGCAATATAACGTTATATTATCTCTGTTTCTTTATGGAAGTATTACTATCC
TTGTATTATAAATTAAAAAGTAAATTtcataaaactatagatatcttgatc

CDS

1227 bp

>Os09t0297400-01 Similar to Phosphate/phosphoenolpyruvate translocator.
ATGCAGAGCGCGGCGGCCGTCGGGCTCCTCCGGCCATGCGGCGCCACCACCGCCGCCGCC
CCGCTCCAGCTCCGCAACCCTAGCCCCCGGGGCTTCGGCGTCGGAGTCGGGCAGCCGCTG
CTCCCGCCGAGGGGGCTCCGCCTCTCCGCCGTGGCCCCGCGCGCGGGCATCTCCGCCCGG
CGCATCGGGCTCGTGCCGGCCTCCCCGGAGCAGGAGGATGAGCGGCGGCGGGGCGCACGC
GACGTGGCCGTGGCGGCGACAGCGGCGGCGGCGGGTGAGGCAGGGGCGGAGGAGGGTGGA
GGGCTCGCGAAGACGCTGCAGCTCGGCGCGCTCTTCGGGCTGTGGTACCTCTTCAACATC
TACTTCAACATCTACAACAAGCAGGTTTTGAAGGTTTTTCCATACCCCATAAACATCACA
AATGTCCAGTTTGCTGTCGGCACTGTCATTGCTCTGTTCATGTGGATTACCGGTATCCTT
AAAAGACCAAAGATCTCCGGTGCGCAGCTTGCTGCTATCCTTCCTCTCGCTATGGTCCAC
ACCATGGGCAATCTTTTCACGAACATGAGCCTTGGAAAGGTTGCAGTGTCATTTACACAT
ACTATCAAGGCTATGGAGCCTTTCTTTTCAGTTCTGCTTTCAGCACTTTTCCTCGGAGAG
ATGCCTACTCCTTTTGTTGTATTGTCTCTTGTTCCAATTGTTGGTGGTGTGGCATTGGCA
TCTCTTACTGAAGCTTCATTTAACTGGGCTGGATTTTGGAGTGCAATGGCCTCAAATGTC
ACCTTCCAGTCAAGGAATGTGTTGAGCAAGAAGCTTATGGTGAAGAAGGAGGAATCTCTG
GACAACATTACCCTCTTCTCAATCATTACAGTGATGTCATTCTTCCTCTTGGCCCCAGTA
ACCTTGCTAACAGAGGGTGTCAAAGTCACTCCGACAGTTCTGCAGTCTGCTGGTCTGAAC
TTAAAACAGATATACACAAGGTCACTGATTGCTGCGTTCTGTTTCCATGCATACCAACAG
GTGTCGTACATGATCCTGGCAAGAGTGTCCCCTGTTACTCACTCGGTGGGTAACTGTGTC
AAGCGAGTGGTGGTCATTGTGACATCCGTTCTGTTCTTCCGCACCCCTGTTTCGCCTATC
AACTCTCTGGGAACCGGAGTCGCTCTTGCCGGAGTTTTCCTGTACTCACAATTGAAGCGG
CTTAAACCCAAGCCCAAGACTGCCTGA

Protein

409 aa

>Os09t0297400-01 Similar to Phosphate/phosphoenolpyruvate translocator.
MQSAAAVGLLRPCGATTAAAPLQLRNPSPRGFGVGVGQPLLPPRGLRLSAVAPRAGISAR
RIGLVPASPEQEDERRRGARDVAVAATAAAAGEAGAEEGGGLAKTLQLGALFGLWYLFNI
YFNIYNKQVLKVFPYPINITNVQFAVGTVIALFMWITGILKRPKISGAQLAAILPLAMVH
TMGNLFTNMSLGKVAVSFTHTIKAMEPFFSVLLSALFLGEMPTPFVVLSLVPIVGGVALA
SLTEASFNWAGFWSAMASNVTFQSRNVLSKKLMVKKEESLDNITLFSIITVMSFFLLAPV
TLLTEGVKVTPTVLQSAGLNLKQIYTRSLIAAFCFHAYQQVSYMILARVSPVTHSVGNCV
KRVVVIVTSVLFFRTPVSPINSLGTGVALAGVFLYSQLKRLKPKPKTA*

5'UTR

chr09:7225546..7225657 (- strand) : 112 bp

CDS

chr09:7225162..7225545 (- strand) : 384 bp

chr09:7224196..7224318 (- strand) : 123 bp

chr09:7223950..7224102 (- strand) : 153 bp

chr09:7223753..7223838 (- strand) : 86 bp

chr09:7223544..7223628 (- strand) : 85 bp

chr09:7223135..7223254 (- strand) : 120 bp

chr09:7222981..7223049 (- strand) : 69 bp

chr09:7222680..7222809 (- strand) : 130 bp

chr09:7222520..7222596 (- strand) : 77 bp

3'UTR

chr09:7222188..7222519 (- strand) : 332 bp

FASTA

>Os09t0297400-01 class=Sequence position=chr09:7222188..7225657 (- strand)
GCCATCCTCG AGCACTCCGC CGCCGCCGCC GCCGCCGCCT CGACGCATCC GCTTCCCCCC ACGCGAGCCG AAGCTTCTAG
AACCTTCGAG GCCGCGGCTC CCACGGGCGG CAATGCAGAG CGCGGCGGCC GTCGGGCTCC TCCGGCCATG CGGCGCCACC
ACCGCCGCCG CCCCGCTCCA GCTCCGCAAC CCTAGCCCCC GGGGCTTCGG CGTCGGAGTC GGGCAGCCGC TGCTCCCGCC
GAGGGGGCTC CGCCTCTCCG CCGTGGCCCC GCGCGCGGGC ATCTCCGCCC GGCGCATCGG GCTCGTGCCG GCCTCCCCGG
AGCAGGAGGA TGAGCGGCGG CGGGGCGCAC GCGACGTGGC CGTGGCGGCG ACAGCGGCGG CGGCGGGTGA GGCAGGGGCG
GAGGAGGGTG GAGGGCTCGC GAAGACGCTG CAGCTCGGCG CGCTCTTCGG GCTGTGGTAC CTCTTCAACA TCTACTTCAA
CATCTACAAC AAGCAGGTGA GGCGGCTTTA ACTTTGATCC ATTGCCGTCG CCAATTTGGC GGAGATTTGG GGGAGACTAG
GATGTTTCAT TTGGGATTTA TTACATGTGA TTCTGTTAGT GGTGAATGGT TCGCTGATGG CAATCTGATC TTGGATCGGG
CATTCGCCTT TTAGATTCAG CAAAGATCTA CTCGCTCCGT TGAGATTGTT GAGCAAAAGA GGGAACTATT TTGAAATTGA
TTTTATTTGT CTTGTGAATC ACTTCTAATT ATAACCTTTT TTGCCTCCAT ATGCTGGTAT ATGTCGTTTT CTGTAAATGT
TTCTAACCCA CTTACTGAAT GGGTGCAAGA ATTTGCTCAA GCTCGTCTAG ATCTTGGATT AGTACAAACT CAAAATGTAT
ATTGTGGAAA GAAGAGCGAT TTAGTTTATT TCGTTGGGCT TTTAGAGATG TTCCCCCACG TTACACCTTT TCTATCAAAC
TTTTGTCACA ACTTTCTAAA AGGTACATTT GTGGATAGTT TATGTTTGTA TCTGGTATAA GATGTCGAAC GGGTAATATT
GCTAAAATCA TGTCTTCTAG TGAGTGCAGT AGACAATTTC CCATGTCTTC TGGTAGAAAT ATAGAATATA GAAGGAAAAA
GAACAAACAT TTCTTCAAAG TTGTCCAGAC TCATATGTAT CCATGTCTTA TAGTGAGTAT ATCCAATGTT CTACCAAAAC
AAATTGTGCT AGGGATGGAA GTTTGTTTTC GTTCATTATA TATGGTGTCA CTTATGGTTA ATCTGTTGAA ATTTCTTGAT
CTCCTCATTG GCTTCGTGTA GATAAAACAA CTTTCCTTTA TTGTTCCTAT GTGTGACAGG TTTTGAAGGT TTTTCCATAC
CCCATAAACA TCACAAATGT CCAGTTTGCT GTCGGCACTG TCATTGCTCT GTTCATGTGG ATTACCGGTA TCCTTAAAAG
ACCAAAGATC TCCGGTGCGC AGGTAATTAT ATTTCTCTAT AAGATACATC GTGACAACAT TCGATACACA TGTATTGCAC
TATGAAGCCA ACTATTGTAA CTGTCCTTAT TTCAGCTTGC TGCTATCCTT CCTCTCGCTA TGGTCCACAC CATGGGCAAT
CTTTTCACGA ACATGAGCCT TGGAAAGGTT GCAGTGTCAT TTACACATAC TATCAAGGCT ATGGAGCCTT TCTTTTCAGT
TCTGCTTTCA GCACTTTTCC TCGGAGAGGT AATTTTTTAA TGTTCTGCAC TGGTGCCCAG TGATAACTAT GCAACCGCAT
ATAATCTTAG AAAAACCATC TGTTTCTTGG TTTGGTTCTC ATACATAATC ACTTTGCAGA TGCCTACTCC TTTTGTTGTA
TTGTCTCTTG TTCCAATTGT TGGTGGTGTG GCATTGGCAT CTCTTACTGA AGCTTCATTT AACTGGTAAG GGATATAGCT
AGCTATTTTT GTCTTCGCTG TGGAAACTGC AAATATAACA TAAGCCTGCT GATAGCAGAG CTAACAAAGT GCTATATGCT
TGATTCGTCT GTAATTTATA TGATATCAGG GCTGGATTTT GGAGTGCAAT GGCCTCAAAT GTCACCTTCC AGTCAAGGAA
TGTGTTGAGC AAGAAGCTTA TGGTGAAGAA GGAGGTAACT GAATAATTAG AGTGCGGTCA TCATAGATAT TGGCAACTGA
ATTGCAGAAT TAGTACAAGT GTGTGTTTCT CTTGAATAGT CTGCTTTAGT AATATTCATC AGTTATTTTA GGATGTGTCA
CTTCATAATG TTCTGTTTCA AGATAAAATT TGTATTTTAA CAGAGCTTTT TATTTATGTC CACACTTGCC TATCTGTGGC
TTTTTCCTTG AACCTCTATT GTTTGTCACC ATGGCTCTTA CATAACTTAA TTCTAATGAT CTTCTTTCCC AATTTCTGAT
CAGGAATCTC TGGACAACAT TACCCTCTTC TCAATCATTA CAGTGATGTC ATTCTTCCTC TTGGCCCCAG TAACCTTGCT
AACAGAGGGT GTCAAAGTCA CTCCGACAGT TCTGCAGTCT GCTGTGAGCA CCTTGATATT TAATTATAGA CAAATTGCTC
CTTACATATT GTTTGGTGCA ATTTTTGACT ATTTTCTTTC TTATGTAGGG TCTGAACTTA AAACAGATAT ACACAAGGTC
ACTGATTGCT GCGTTCTGTT TCCATGCATA CCAACAGGTC AGCCATCTAA TTGATTTTCT AAAAATAGCT TGGCCTTTTG
AAATCTCTGG ATGCGCTTGT TCATTTCAGA TAGATTCTAT GTGCTGAATA CATTACAGTT GTTACATTGA TGAATCATCA
TACATGTGCA AAGCCCATGT CTTGCTGATC TCACATAATT TCTTGAAGGT GTCGTACATG ATCCTGGCAA GAGTGTCCCC
TGTTACTCAC TCGGTGGGTA ACTGTGTCAA GCGAGTGGTG GTCATTGTGA CATCCGTTCT GTTCTTCCGC ACCCCTGTTT
CGCCTATCAA CTCTCTGGGT AAGAATCATT TTCTGTTCAC TTCTGTATCA AATTGACTGC ATCGCACCTC CTTTACATAT
CCAAATATTT GCGCCCTGCA GGAACCGGAG TCGCTCTTGC CGGAGTTTTC CTGTACTCAC AATTGAAGCG GCTTAAACCC
AAGCCCAAGA CTGCCTGATT GTGTCTTGGT ATCTATCGTG AAGAACCGTA GAAGCATTGC CACACGCCAT CGGAATGAGT
GCCTTAGCTT AGAATGATCC TTGGAGAAGC TCCATCCAGT GAACTGATGC TGCTGTGTGT ATCGTTTGTA GTTGAGTTAC
TAGCGTGCTA ATCGTGGCAA GGTTTTTGTG TCTTCTTTAC CACCTTATGC TTGAACAGTC AATTATTTTG TTGTATCAAT
AAATTTCGTG CAATATAACG TTATATTATC TCTGTTTCTT TATGGAAGTA TTACTATCCT TGTATTATAA ATTAAAAAGT
AAATTtcata aaactataga tatcttgatc 

Locus: Os09g0297400

Loading...

Locus: Os09g0297400

Loading...