Os09t0298200-01

Locus

Os09g0298200

Description

Chloroplastic/amyloplastic ADP-glucose pyrophosphorylase small subunit 1, Starch synthesis in the early stage of developing endosperm

RAP-DB Gene Symbol Synonym(s)

OsAGPS1

RAP-DB Gene Name Synonym(s)

ADP-glucose pyrophosphorylase small subunit 1

CGSNL Gene Symbol

AGPS1

CGSNL Gene Name

ADP-GLUCOSE PYROPHOSPHORYLASE SMALL SUBUNIT 1

Oryzabase Gene Symbol Synonym(s)

OsAGPS1, APS1, OsAPS1, AGPsma

Oryzabase Gene Name Synonym(s)

sativa ADP-glucose pyrophosphorylase small subunit 1, ADP-glucose Pyrophosphorylase small subunit 1, AGPase small subunit 1, Adenosine diphosphate glucose pyrophosphorylase, adenosine diphosphoglucose pyrophosphorylase, ADP-glucose pyrophosphorylase small unit 1, AGPase S1

Transcript Evidence

AK073146

Protein Evidence

Q69T99

Literature

PMID: 17406793

Note

Manual Curation

July 16, 2019

Gene Ontology (GO)

Biological Process: glycogen biosynthetic process (GO:0005978)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: glucose-1-phosphate adenylyltransferase activity (GO:0008878)

Molecular Function: nucleotidyltransferase activity (GO:0016779)

Functional domain (InterPro)

Nucleotide-diphospho-sugar transferases (IPR029044)

Trimeric LpxA-like superfamily (IPR011004)

Glucose-1-phosphate adenylyltransferase (IPR011831)

Nucleotidyl transferase domain (IPR005835)

ADP-glucose pyrophosphorylase, conserved site (IPR005836)

Experimentally confirmed subcellular location

amyloplast (GO:0009501)

chloroplast (GO:0009507)

Full-length cDNA

J033022L06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0298200-01)

RiceXPro (AK073146)

Others

Oryzabase (8255)

KEGG (Os09t0298200-01 (EC:2.7.7.27))

Transcript

1951 bp

>Os09t0298200-01 Chloroplastic/amyloplastic ADP-glucose pyrophosphorylase small subunit 1, Starch synthesis in the early stage of developing endosperm
ACACATCATCACTGGGACAACCAAAGAAAAAGAAAAAAAAAGAGAAAAAAAGAGGGAACT
TTTCACGGCCGCTGAAGCCTCTGACACTCCACTGTAGTGTGTCAGTACTCCGGCCACCTC
TCTCGGCCGTTGCTCTCCCATGGCGATGATGGCGATGGGCGCGGCGTCCTGGGCCCCGAT
CCCGGCGCCGGCGAGGGCGGCGGCCGCATTCTATCCCGGCCGCGATCTTGCGGCGGCGAG
GCGGCGGCGTGGGGCGGCGGCGAGGAGGCCGTTCGTGTTCACGCCGCGTGCCGTGTCGGA
CTCCCGGAGCTCGCAGACGTGCCTCGATCCGGACGCCAGCACGAGTGTTCTTGGGATCAT
CCTTGGAGGTGGTGCTGGGACAAGGCTGTATCCGCTGACAAAGAAGAGGGCGAAGCCGGC
GGTGCCGTTGGGTGCTAATTACAGGCTCATAGATATCCCGGTCAGCAACTGTCTGAACAG
CAATGTGTCGAAGATCTATGTCCTGACACAGTTCAACTCCGCGTCGCTCAATCGTCACCT
CTCGAGGGCCTATGGAAACAACATTGGTGGTTACAAGAACGAGGGGTTTGTTGAAGTTCT
TGCTGCGCAGCAGAGCCCAGAGAATCCTAACTGGTTTCAGGGTACTGCAGATGCTGTGCG
ACAATACTTATGGCTATTTGAGGAACACAATGTTATGGAGTTTCTCATTTTGGCTGGAGA
TCACCTGTACCGTATGGACTACCAAAAGTTCATTCAGGCCCACAGAGAAACAAATGCTGA
TATAACCGTTGCTGCGCTGCCCATGGATGAAGAACGTGCTACAGCATTTGGCCTTATGAA
GATTGATGATGAAGGGAGGATCATTGAATTTGCAGAAAAGCCAAAAGGAGAGAAGTTGAA
ATCAATGATGGTTGACACTACCATACTTGGCCTTGATACTGAGAGGGCAAAGGAATTGCC
TTACATTGCTAGTATGGGAATCTATGTTTTTAGCAAAGATGTGATGCTTAAGCTTCTCCG
TCAAAATTTCCCTGCTGCAAATGACTTTGGAAGCGAGGTTATTCCTGGAGCAACAGAAAT
TGGAATGAGGGTGCAAGCTTACTTATATGATGGTTACTGGGAAGATATTGGTACTATAGA
GGCATTCTACAATGCCAACTTGGGGATAACCAAGAAACCTGTGCCAGATTTTAGCTTCTA
TGACCGTTCTGCCGCAATTTATACGCAACCTCGATACTTGCCTCCATCAAAAGTTCTTGA
TGCTGATGTGACAGACAGTGTTATTGGTGAAGGTTGTGTTATTAGACATTGCACAATCAA
CCATTCTGTGGTTGGACTCCGGTCCTGTATATCTGAAGGCGCAGTGATAGAGGACTCTCT
GCTAATGGGTGCAGACTATTATGAGACGGAGACGGACAAGAAAGCCCTTTCTGAGACTGG
TGGCATTCCCATTGGTATTGGAAAGAATGCACACATCAGAAAAGCAATAATTGACAAGAA
TGCTCGTATTGGAGAAAATGTTAAGATAATCAATGTCGACAATATCCAAGAAGCTTCAAG
GGAGACTGATGGATACTTCATCAAAAGTGGCATTGTCACTGTGATCAAGGACGCCTTAAT
CCCTAGCGGAACAGTCATATAAAGGCAACCAATCACCACTGTACATAAGGTTGGGCCTTG
CAGCATATGGTGATCTGATCTCCAGTGCACATCAAGCAATCAACTTTTAACGCTGTGGTT
TATTCCATGCTGCCAGTTCACCAAGCTCTGCATCAACTTGCAAGGATATCATAAAAAAAA
TAAAAAATAAAAACAGGTGCCACTTAAAGGCACCATTTTACTGTTACTAGTATGAGCAAC
CGCTCTAGAGCTTAGAGGTGTTGTAAGTCCGAAAACCGTGTCTGAAATGTGGGTATTTTG
ATGTGTATAATCTTTGTCCTTTTGCATGATC

CDS

1503 bp

>Os09t0298200-01 Chloroplastic/amyloplastic ADP-glucose pyrophosphorylase small subunit 1, Starch synthesis in the early stage of developing endosperm
ATGGCGATGATGGCGATGGGCGCGGCGTCCTGGGCCCCGATCCCGGCGCCGGCGAGGGCG
GCGGCCGCATTCTATCCCGGCCGCGATCTTGCGGCGGCGAGGCGGCGGCGTGGGGCGGCG
GCGAGGAGGCCGTTCGTGTTCACGCCGCGTGCCGTGTCGGACTCCCGGAGCTCGCAGACG
TGCCTCGATCCGGACGCCAGCACGAGTGTTCTTGGGATCATCCTTGGAGGTGGTGCTGGG
ACAAGGCTGTATCCGCTGACAAAGAAGAGGGCGAAGCCGGCGGTGCCGTTGGGTGCTAAT
TACAGGCTCATAGATATCCCGGTCAGCAACTGTCTGAACAGCAATGTGTCGAAGATCTAT
GTCCTGACACAGTTCAACTCCGCGTCGCTCAATCGTCACCTCTCGAGGGCCTATGGAAAC
AACATTGGTGGTTACAAGAACGAGGGGTTTGTTGAAGTTCTTGCTGCGCAGCAGAGCCCA
GAGAATCCTAACTGGTTTCAGGGTACTGCAGATGCTGTGCGACAATACTTATGGCTATTT
GAGGAACACAATGTTATGGAGTTTCTCATTTTGGCTGGAGATCACCTGTACCGTATGGAC
TACCAAAAGTTCATTCAGGCCCACAGAGAAACAAATGCTGATATAACCGTTGCTGCGCTG
CCCATGGATGAAGAACGTGCTACAGCATTTGGCCTTATGAAGATTGATGATGAAGGGAGG
ATCATTGAATTTGCAGAAAAGCCAAAAGGAGAGAAGTTGAAATCAATGATGGTTGACACT
ACCATACTTGGCCTTGATACTGAGAGGGCAAAGGAATTGCCTTACATTGCTAGTATGGGA
ATCTATGTTTTTAGCAAAGATGTGATGCTTAAGCTTCTCCGTCAAAATTTCCCTGCTGCA
AATGACTTTGGAAGCGAGGTTATTCCTGGAGCAACAGAAATTGGAATGAGGGTGCAAGCT
TACTTATATGATGGTTACTGGGAAGATATTGGTACTATAGAGGCATTCTACAATGCCAAC
TTGGGGATAACCAAGAAACCTGTGCCAGATTTTAGCTTCTATGACCGTTCTGCCGCAATT
TATACGCAACCTCGATACTTGCCTCCATCAAAAGTTCTTGATGCTGATGTGACAGACAGT
GTTATTGGTGAAGGTTGTGTTATTAGACATTGCACAATCAACCATTCTGTGGTTGGACTC
CGGTCCTGTATATCTGAAGGCGCAGTGATAGAGGACTCTCTGCTAATGGGTGCAGACTAT
TATGAGACGGAGACGGACAAGAAAGCCCTTTCTGAGACTGGTGGCATTCCCATTGGTATT
GGAAAGAATGCACACATCAGAAAAGCAATAATTGACAAGAATGCTCGTATTGGAGAAAAT
GTTAAGATAATCAATGTCGACAATATCCAAGAAGCTTCAAGGGAGACTGATGGATACTTC
ATCAAAAGTGGCATTGTCACTGTGATCAAGGACGCCTTAATCCCTAGCGGAACAGTCATA
TAA

Protein

500 aa

>Os09t0298200-01 Chloroplastic/amyloplastic ADP-glucose pyrophosphorylase small subunit 1, Starch synthesis in the early stage of developing endosperm
MAMMAMGAASWAPIPAPARAAAAFYPGRDLAAARRRRGAAARRPFVFTPRAVSDSRSSQT
CLDPDASTSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNVSKIY
VLTQFNSASLNRHLSRAYGNNIGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLF
EEHNVMEFLILAGDHLYRMDYQKFIQAHRETNADITVAALPMDEERATAFGLMKIDDEGR
IIEFAEKPKGEKLKSMMVDTTILGLDTERAKELPYIASMGIYVFSKDVMLKLLRQNFPAA
NDFGSEVIPGATEIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAAI
YTQPRYLPPSKVLDADVTDSVIGEGCVIRHCTINHSVVGLRSCISEGAVIEDSLLMGADY
YETETDKKALSETGGIPIGIGKNAHIRKAIIDKNARIGENVKIINVDNIQEASRETDGYF
IKSGIVTVIKDALIPSGTVI*

5'UTR

chr09:7249675..7249813 (- strand) : 139 bp

CDS

chr09:7249471..7249674 (- strand) : 204 bp

chr09:7248552..7248848 (- strand) : 297 bp

chr09:7247799..7248068 (- strand) : 270 bp

chr09:7247529..7247708 (- strand) : 180 bp

chr09:7247246..7247349 (- strand) : 104 bp

chr09:7247034..7247145 (- strand) : 112 bp

chr09:7246756..7246854 (- strand) : 99 bp

chr09:7246563..7246682 (- strand) : 120 bp

chr09:7245951..7246067 (- strand) : 117 bp

3'UTR

chr09:7245924..7245950 (- strand) : 27 bp

chr09:7245434..7245715 (- strand) : 282 bp

FASTA

>Os09t0298200-01 class=Sequence position=chr09:7245434..7249813 (- strand)
ACACATCATC ACTGGGACAA CCAAAGAAAA AGAAAAAAAA AGAGAAAAAA AGAGGGAACT TTTCACGGCC GCTGAAGCCT
CTGACACTCC ACTGTAGTGT GTCAGTACTC CGGCCACCTC TCTCGGCCGT TGCTCTCCCA TGGCGATGAT GGCGATGGGC
GCGGCGTCCT GGGCCCCGAT CCCGGCGCCG GCGAGGGCGG CGGCCGCATT CTATCCCGGC CGCGATCTTG CGGCGGCGAG
GCGGCGGCGT GGGGCGGCGG CGAGGAGGCC GTTCGTGTTC ACGCCGCGTG CCGTGTCGGA CTCCCGGAGC TCGCAGACGT
GCCTCGATCC GGACGCCAGC ACGGTACGCC GCGATCTCGC CGCCGGTGCC CAAAAAAATT CTACTCTTCC AGCGCTCGCT
TTTTTCTTTG CGTTCACGAG GGAGAAAAGT TCGGATCCTT TTGGGTTGGG AAAATCGAAG GGTCGTTCTT GGGATTCGAT
GTGTTGCGGT TATTTTACTC GACACATTTG GATGAGCGAA ATGTGTTTGA TATGTTTCTT GTGGGGATTC CTGCGAGTGC
GAAGTGTTTG TTTTTTTAGA GTGTTTTGGT GTCGATTTCT CGGTGATTCT ATCAGCTGTT GCGTTCAGTA CTCTCTGTGA
TTCAAGAAAC GGTGGAAAGA TGATGGTGAC AGTATCTCTA GTTTAGTTGT TGGATGAAAT ATTGACATAT CTTTAACGGT
GGAAAGGTGA TTGTTAGTGA GAACCCCATA ATAATTAATT AGTGGAGGAT CTATCGTGGT CCATGGCTTG AATTTAATAA
TTGGCTCCAG ATCTGTTGTA GTACTTTTGA GTTTATAATT TATTAGATTC TGTGGTAGAA CTAGAAGTAC AGAACTTGGA
ACTCAAGAGC ATTTCATCTG TTATCTATAT ATAGTCTGAT GATGATTTGT ATTATTATTT TTACATCCAA TTTTTAATCC
TGCAGAGTGT TCTTGGGATC ATCCTTGGAG GTGGTGCTGG GACAAGGCTG TATCCGCTGA CAAAGAAGAG GGCGAAGCCG
GCGGTGCCGT TGGGTGCTAA TTACAGGCTC ATAGATATCC CGGTCAGCAA CTGTCTGAAC AGCAATGTGT CGAAGATCTA
TGTCCTGACA CAGTTCAACT CCGCGTCGCT CAATCGTCAC CTCTCGAGGG CCTATGGAAA CAACATTGGT GGTTACAAGA
ACGAGGGGTT TGTTGAAGTT CTTGCTGCGC AGCAGAGCCC AGAGAATCCT AACTGGTTTC AGGTATCTTG GTTAATCTGT
ATTAACTTGC CAAATTTTTT ATAGTAGTAC TGTATTAGTT TGAATTGACT CGGTAAGTGG TAATTTTTGT ACTATGCAGG
TACTGGATGT TTCTGCTTCT GTGTATTATT GAATGGTCTC GTTTAGCTGC AAAGATGCAT GAATGCCAGT TAAAGTTTAT
ACTTTATAGG GTACAAAGAA AAGAAGGGGA TACATAATTA ATATGAACAT ACACCCTGTT TTACGGAACA AAAGAAATAT
TAGGGTTAAT GTACTCCTGT TGATTCACTC TTCCATATTT TCTCACATTT ATAGTTAAGT GAAACTGTTC ACTAGTTTAG
ATGTTCCAAT GATTTCTTTG GAATTGCAAA CTAGAGTTAA CATTGATAGA TGAGCTCTTA GGTTACCAAC TTTCATGTTA
TATGGTTTCT GTATGACAAT ACCTTAAGGA CGCTGCCTAA TTTATTTTGT TTCTTTCTGT CTCAGGGTAC TGCAGATGCT
GTGCGACAAT ACTTATGGCT ATTTGAGGAA CACAATGTTA TGGAGTTTCT CATTTTGGCT GGAGATCACC TGTACCGTAT
GGACTACCAA AAGTTCATTC AGGCCCACAG AGAAACAAAT GCTGATATAA CCGTTGCTGC GCTGCCCATG GATGAAGAAC
GTGCTACAGC ATTTGGCCTT ATGAAGATTG ATGATGAAGG GAGGATCATT GAATTTGCAG AAAAGCCAAA AGGAGAGAAG
TTGAAATCAA TGATGGTAAT TGATGAGTCA TCCGTTGAGA CCATATGCAA CCTGATCTGT TGAAGCATAC ATTTCAGTGA
TTGTCTGCAT GTTTTGATCT TGCAGGTTGA CACTACCATA CTTGGCCTTG ATACTGAGAG GGCAAAGGAA TTGCCTTACA
TTGCTAGTAT GGGAATCTAT GTTTTTAGCA AAGATGTGAT GCTTAAGCTT CTCCGTCAAA ATTTCCCTGC TGCAAATGAC
TTTGGAAGCG AGGTTATTCC TGGAGCAACA GAAATTGGAA TGAGGGTACG CTATGCTCTT GAAACTTGTA GCATGTAGGG
AATTTTTATC CTTCTCTCAG TTCATGCTGT AGGTTTTGTG AAGTTTGGTA TGTAAACTGC AGTTACATCA TTTATTGTGA
AATGTTACTT CTTTACTTAA TTTTTACTTT GCATGTTTGC TTATGCTGCT AATGTATTTG ATAGGTGCAA GCTTACTTAT
ATGATGGTTA CTGGGAAGAT ATTGGTACTA TAGAGGCATT CTACAATGCC AACTTGGGGA TAACCAAGAA ACCTGTGCCA
GATTTTAGGT AAGGTTTACA TTTTGCATGG TGAAAACAAG TTACTTTTAA AAGGGTGCAT TTCTGCTGAA TTTTCTTCCT
ATTTTTGAGC AAACATTATT GTGTGCAGCT TCTATGACCG TTCTGCCGCA ATTTATACGC AACCTCGATA CTTGCCTCCA
TCAAAAGTTC TTGATGCTGA TGTGACAGAC AGTGTTATTG GTGAAGGTTG TGTTATTAGA GTAAGTATCC TTTTCAGATG
AATTATCATA GCGCTTCCTT CTATGATCTG TGGATAGTAT TAGATCATAA CATATTAGGA CCTTGAGTTA TTACTTGTTA
GTCGAACATT TCTTTTTCAT TGCTTCAAAA CAGAGACCCT AAATTTGTTG ACATGCCTTT CCCCCTTTAT TTTGGCTAGC
ATTGCACAAT CAACCATTCT GTGGTTGGAC TCCGGTCCTG TATATCTGAA GGCGCAGTGA TAGAGGACTC TCTGCTAATG
GGTGCAGACT ATTATGAGGT AAAATAAAAC AAAACTATAC TATATTATGG TGTATTGGTG TTGTGGGAAC TTAATTGTGC
TTTTTGTTCA GACGGAGACG GACAAGAAAG CCCTTTCTGA GACTGGTGGC ATTCCCATTG GTATTGGAAA GAATGCACAC
ATCAGAAAAG CAATAATTGA CAAGAATGCT CGTATTGGAG AAAATGTTAA GGTATTTCAT ATATATTTAT ACTTTTGGTT
GTCAATCTGA TGAAGTGTGC CTTCTGTATT AACTGATCAA CTATTCATTA CTTGAAAGAA AAGAGAGGGA CAAGCATATT
TGTTTGAATA CAAACTTGGT ACTTTCTCAT GCTTTTTGTT AAAGGTGGCC TTTTGCAAAT GTGCATCTTG CATCACTGGT
TTGAAAGCCC TTTATCATTA AAAAATACTA CTATGTCATC ATACTTTTTC CCCCTAAATT ATCTTTCTTT TCAAATGCTA
TATGTCTTTT CTTGCCATGG GTTTTTGCCT TGTTGAGTAT GGATCTTTAA TTATTTACTT ACTAAGCACA AACTGAAAAA
ATCCAGGCAA CCCATATGGA TCGATTTACA TATTGTTTCT CTCACTTTTC CAGAGATGAC CAGTTGATAC TGAACTGAAC
AAAATGATGT GCAATGTTTA TTGCATTAAT TAATGATCAA TCTTATATGA TCTGTTGCTT GTACAGATAA TCAATGTCGA
CAATATCCAA GAAGCTTCAA GGGAGACTGA TGGATACTTC ATCAAAAGTG GCATTGTCAC TGTGATCAAG GACGCCTTAA
TCCCTAGCGG AACAGTCATA TAAAGGCAAC CAATCACCAC TGTACATAAG GTTCTCTCAA ATTCTCATAT TTATTCTATT
TAGAGCGTTT GGACATCACC AATTCACCAT GAAATGGGAA GCGTCTTTTA TTTTCCCTCT TACAAACAAT TTCTACCAAA
ATTGGATCGA CTGCCTTGCT TAATGCTAGA ATTTGCTTAG TAGCTGGTAA GCCTCATATT TATGCTTAAA TAAGTGATTC
TTTTGTTCTG TAATGCAGGT TGGGCCTTGC AGCATATGGT GATCTGATCT CCAGTGCACA TCAAGCAATC AACTTTTAAC
GCTGTGGTTT ATTCCATGCT GCCAGTTCAC CAAGCTCTGC ATCAACTTGC AAGGATATCA TAAAAAAAAT AAAAAATAAA
AACAGGTGCC ACTTAAAGGC ACCATTTTAC TGTTACTAGT ATGAGCAACC GCTCTAGAGC TTAGAGGTGT TGTAAGTCCG
AAAACCGTGT CTGAAATGTG GGTATTTTGA TGTGTATAAT CTTTGTCCTT TTGCATGATC 

Locus: Os09g0298200

Loading...

Locus: Os09g0298200

Loading...