Os09t0298200-02

Locus

Os09g0298200

Description

Similar to Brittle 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AGPS1

CGSNL Gene Name

ADP-GLUCOSE PYROPHOSPHORYLASE SMALL SUBUNIT 1

Oryzabase Gene Symbol Synonym(s)

OsAGPS1, APS1, OsAPS1, AGPsma

Oryzabase Gene Name Synonym(s)

sativa ADP-glucose pyrophosphorylase small subunit 1, ADP-glucose Pyrophosphorylase small subunit 1, AGPase small subunit 1, Adenosine diphosphate glucose pyrophosphorylase, adenosine diphosphoglucose pyrophosphorylase, ADP-glucose pyrophosphorylase small unit 1, AGPase S1

Transcript Evidence

AK060270 (DDBJ, Best hit)

Protein Evidence

D3U2H7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: glycogen biosynthetic process (GO:0005978)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: glucose-1-phosphate adenylyltransferase activity (GO:0008878)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: nucleotidyltransferase activity (GO:0016779)

Functional domain (InterPro)

Nucleotidyl transferase (IPR005835)

ADP-glucose pyrophosphorylase, conserved site (IPR005836)

Trimeric LpxA-like (IPR011004)

Glucose-1-phosphate adenylyltransferase (IPR011831)

Full-length cDNA

001-005-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0298200-02)

RiceXPro (AK060270)

Others

Oryzabase (8255)

KEGG (Os09t0298200-02 (EC:2.7.7.27))

Transcript

1749 bp

>Os09t0298200-02 Similar to Brittle 2.
GAAAAAAAGAGGGAACTTTTCACGGCCGCTGAAGCCTCTGACACTCCACTGTAGTGTGTC
AGTACTCCGGCCACCTCTCTCGGCCGTTGCTCTCCCATGGCGATGATGGCGATGGGCGCG
GCGTCCTGGGCCCCGATCCCGGCGCCGGCGAGGGCGGCGGCCGCATTCTATCCCGGCCGC
GATCTTGCGGCGGCGAGGCGGCGGCGTGGGGCGGCGGCGAGGAGGCCGTTCGTGTTCACG
CCGCGTGCCGTGTCGGACTCCCGGAGCTCGCAGACGTGCCTCGATCCGGACGCCAGCACG
AGTGTTCTTGGGATCATCCTTGGAGGTGGTGCTGGGACAAGGCTGTATCCGCTGACAAAG
AAGAGGGCGAAGCCGGCGGTGCCGTTGGGTGCTAATTACAGGCTCATAGATATCCCGGTC
AGCAACTGTCTGAACAGCAATGTGTCGAAGATCTATGTCCTGACACAGTTCAACTCCGCG
TCGCTCAATCGTCACCTCTCGAGGGCCTATGGAAACAACATTGGTGGTTACAAGAACGAG
GGGTTTGTTGAAGTTCTTGCTGCGCAGCAGAGCCCAGAGAATCCTAACTGGTTTCAGGGT
ACTGCAGATGCTGTGCGACAATACTTATGGCTATTTGAGGAACACAATGTTATGGAGTTT
CTCATTTTGGCTGGAGATCACCTGTACCGTATGGACTACCAAAAGTTCATTCAGGCCCAC
AGAGAAACAAATGCTGATATAACCGTTGCTGCGCTGCCCATGGATGAAGAACGTGCTACA
GCATTTGGCCTTATGAAGATTGATGATGAAGGGAGGATCATTGAATTTGCAGAAAAGCCA
AAAGGAGAGAAGTTGAAATCAATGATGGTTGACACTACCATACTTGGCCTTGATACTGAG
AGGGCAAAGGAATTGCCTTACATTGCTAGTATGGGAATCTATGTTTTTAGCAAAGATGTG
ATGCTTAAGCTTCTCCGTCAAAATTTCCCTGCTGCAAATGACTTTGGAAGCGAGGTTATT
CCTGGAGCAACAGAAATTGGAATGAGGGTGCAAGCTTACTTATATGATGGTTACTGGGAA
GATATTGGTACTATAGAGGCATTCTACAATGCCAACTTGGGGATAACCAAGAAACCTGTG
CCAGATTTTAGCTTCTATGACCGTTCTGCCGCAATTTATACGCAACCTCGATACTTGCCT
CCATCAAAAGTTCTTGATGCTGATGTGACAGACAGTGTTATTGGTGAAGGTTGTGTTATT
AGACATTGCACAATCAACCATTCTGTGGTTGGACTCCGGTCCTGTATATCTGAAGGCGCA
GTGATAGAGGACTCTCTGCTAATGGGTGCAGACTATTATGAGACGGAGACGGACAAGAAA
GCCCTTTCTGAGACTGGTGGCATTCCCATTGGTATTGGAAAGAATGCACACATCAGAAAA
GCAATAATTGACAAGAATGCTCGTATTGGAGAAAATGTTAAGATAATCAATGTCGACAAT
ATCCAAGAAGCTTCAAGGGAGACTGATGGATACTTCATCAAAAGTGGCATTGTCACTGTG
ATCAAGGACGCCTTAATCCCTAGCGGAACAGTCATATAAAGGCAACCAATCACCACTGTA
CATAAGGTTGGGCCTTGCAGCATATGGTGATCTGATCTCCAGTGCACATCAAGCAATCAA
CTTTTAACGCTGTGGTTTATTCCATGCTGCCAGTTCACCAAGCTCTGCATCAACTTGCAA
GGATATCAT

CDS

1503 bp

>Os09t0298200-02 Similar to Brittle 2.
ATGGCGATGATGGCGATGGGCGCGGCGTCCTGGGCCCCGATCCCGGCGCCGGCGAGGGCG
GCGGCCGCATTCTATCCCGGCCGCGATCTTGCGGCGGCGAGGCGGCGGCGTGGGGCGGCG
GCGAGGAGGCCGTTCGTGTTCACGCCGCGTGCCGTGTCGGACTCCCGGAGCTCGCAGACG
TGCCTCGATCCGGACGCCAGCACGAGTGTTCTTGGGATCATCCTTGGAGGTGGTGCTGGG
ACAAGGCTGTATCCGCTGACAAAGAAGAGGGCGAAGCCGGCGGTGCCGTTGGGTGCTAAT
TACAGGCTCATAGATATCCCGGTCAGCAACTGTCTGAACAGCAATGTGTCGAAGATCTAT
GTCCTGACACAGTTCAACTCCGCGTCGCTCAATCGTCACCTCTCGAGGGCCTATGGAAAC
AACATTGGTGGTTACAAGAACGAGGGGTTTGTTGAAGTTCTTGCTGCGCAGCAGAGCCCA
GAGAATCCTAACTGGTTTCAGGGTACTGCAGATGCTGTGCGACAATACTTATGGCTATTT
GAGGAACACAATGTTATGGAGTTTCTCATTTTGGCTGGAGATCACCTGTACCGTATGGAC
TACCAAAAGTTCATTCAGGCCCACAGAGAAACAAATGCTGATATAACCGTTGCTGCGCTG
CCCATGGATGAAGAACGTGCTACAGCATTTGGCCTTATGAAGATTGATGATGAAGGGAGG
ATCATTGAATTTGCAGAAAAGCCAAAAGGAGAGAAGTTGAAATCAATGATGGTTGACACT
ACCATACTTGGCCTTGATACTGAGAGGGCAAAGGAATTGCCTTACATTGCTAGTATGGGA
ATCTATGTTTTTAGCAAAGATGTGATGCTTAAGCTTCTCCGTCAAAATTTCCCTGCTGCA
AATGACTTTGGAAGCGAGGTTATTCCTGGAGCAACAGAAATTGGAATGAGGGTGCAAGCT
TACTTATATGATGGTTACTGGGAAGATATTGGTACTATAGAGGCATTCTACAATGCCAAC
TTGGGGATAACCAAGAAACCTGTGCCAGATTTTAGCTTCTATGACCGTTCTGCCGCAATT
TATACGCAACCTCGATACTTGCCTCCATCAAAAGTTCTTGATGCTGATGTGACAGACAGT
GTTATTGGTGAAGGTTGTGTTATTAGACATTGCACAATCAACCATTCTGTGGTTGGACTC
CGGTCCTGTATATCTGAAGGCGCAGTGATAGAGGACTCTCTGCTAATGGGTGCAGACTAT
TATGAGACGGAGACGGACAAGAAAGCCCTTTCTGAGACTGGTGGCATTCCCATTGGTATT
GGAAAGAATGCACACATCAGAAAAGCAATAATTGACAAGAATGCTCGTATTGGAGAAAAT
GTTAAGATAATCAATGTCGACAATATCCAAGAAGCTTCAAGGGAGACTGATGGATACTTC
ATCAAAAGTGGCATTGTCACTGTGATCAAGGACGCCTTAATCCCTAGCGGAACAGTCATA
TAA

Protein

500 aa

>Os09t0298200-02 Similar to Brittle 2.
MAMMAMGAASWAPIPAPARAAAAFYPGRDLAAARRRRGAAARRPFVFTPRAVSDSRSSQT
CLDPDASTSVLGIILGGGAGTRLYPLTKKRAKPAVPLGANYRLIDIPVSNCLNSNVSKIY
VLTQFNSASLNRHLSRAYGNNIGGYKNEGFVEVLAAQQSPENPNWFQGTADAVRQYLWLF
EEHNVMEFLILAGDHLYRMDYQKFIQAHRETNADITVAALPMDEERATAFGLMKIDDEGR
IIEFAEKPKGEKLKSMMVDTTILGLDTERAKELPYIASMGIYVFSKDVMLKLLRQNFPAA
NDFGSEVIPGATEIGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAAI
YTQPRYLPPSKVLDADVTDSVIGEGCVIRHCTINHSVVGLRSCISEGAVIEDSLLMGADY
YETETDKKALSETGGIPIGIGKNAHIRKAIIDKNARIGENVKIINVDNIQEASRETDGYF
IKSGIVTVIKDALIPSGTVI*

5'UTR

chr09:7249675..7249770 (- strand) : 96 bp

CDS

chr09:7249471..7249674 (- strand) : 204 bp

chr09:7248552..7248848 (- strand) : 297 bp

chr09:7247799..7248068 (- strand) : 270 bp

chr09:7247529..7247708 (- strand) : 180 bp

chr09:7247246..7247349 (- strand) : 104 bp

chr09:7247034..7247145 (- strand) : 112 bp

chr09:7246756..7246854 (- strand) : 99 bp

chr09:7246563..7246682 (- strand) : 120 bp

chr09:7245951..7246067 (- strand) : 117 bp

3'UTR

chr09:7245924..7245950 (- strand) : 27 bp

chr09:7245593..7245715 (- strand) : 123 bp

FASTA

>Os09t0298200-02 class=Sequence position=chr09:7245593..7249770 (- strand)
GAAAAAAAGA GGGAACTTTT CACGGCCGCT GAAGCCTCTG ACACTCCACT GTAGTGTGTC AGTACTCCGG CCACCTCTCT
CGGCCGTTGC TCTCCCATGG CGATGATGGC GATGGGCGCG GCGTCCTGGG CCCCGATCCC GGCGCCGGCG AGGGCGGCGG
CCGCATTCTA TCCCGGCCGC GATCTTGCGG CGGCGAGGCG GCGGCGTGGG GCGGCGGCGA GGAGGCCGTT CGTGTTCACG
CCGCGTGCCG TGTCGGACTC CCGGAGCTCG CAGACGTGCC TCGATCCGGA CGCCAGCACG GTACGCCGCG ATCTCGCCGC
CGGTGCCCAA AAAAATTCTA CTCTTCCAGC GCTCGCTTTT TTCTTTGCGT TCACGAGGGA GAAAAGTTCG GATCCTTTTG
GGTTGGGAAA ATCGAAGGGT CGTTCTTGGG ATTCGATGTG TTGCGGTTAT TTTACTCGAC ACATTTGGAT GAGCGAAATG
TGTTTGATAT GTTTCTTGTG GGGATTCCTG CGAGTGCGAA GTGTTTGTTT TTTTAGAGTG TTTTGGTGTC GATTTCTCGG
TGATTCTATC AGCTGTTGCG TTCAGTACTC TCTGTGATTC AAGAAACGGT GGAAAGATGA TGGTGACAGT ATCTCTAGTT
TAGTTGTTGG ATGAAATATT GACATATCTT TAACGGTGGA AAGGTGATTG TTAGTGAGAA CCCCATAATA ATTAATTAGT
GGAGGATCTA TCGTGGTCCA TGGCTTGAAT TTAATAATTG GCTCCAGATC TGTTGTAGTA CTTTTGAGTT TATAATTTAT
TAGATTCTGT GGTAGAACTA GAAGTACAGA ACTTGGAACT CAAGAGCATT TCATCTGTTA TCTATATATA GTCTGATGAT
GATTTGTATT ATTATTTTTA CATCCAATTT TTAATCCTGC AGAGTGTTCT TGGGATCATC CTTGGAGGTG GTGCTGGGAC
AAGGCTGTAT CCGCTGACAA AGAAGAGGGC GAAGCCGGCG GTGCCGTTGG GTGCTAATTA CAGGCTCATA GATATCCCGG
TCAGCAACTG TCTGAACAGC AATGTGTCGA AGATCTATGT CCTGACACAG TTCAACTCCG CGTCGCTCAA TCGTCACCTC
TCGAGGGCCT ATGGAAACAA CATTGGTGGT TACAAGAACG AGGGGTTTGT TGAAGTTCTT GCTGCGCAGC AGAGCCCAGA
GAATCCTAAC TGGTTTCAGG TATCTTGGTT AATCTGTATT AACTTGCCAA ATTTTTTATA GTAGTACTGT ATTAGTTTGA
ATTGACTCGG TAAGTGGTAA TTTTTGTACT ATGCAGGTAC TGGATGTTTC TGCTTCTGTG TATTATTGAA TGGTCTCGTT
TAGCTGCAAA GATGCATGAA TGCCAGTTAA AGTTTATACT TTATAGGGTA CAAAGAAAAG AAGGGGATAC ATAATTAATA
TGAACATACA CCCTGTTTTA CGGAACAAAA GAAATATTAG GGTTAATGTA CTCCTGTTGA TTCACTCTTC CATATTTTCT
CACATTTATA GTTAAGTGAA ACTGTTCACT AGTTTAGATG TTCCAATGAT TTCTTTGGAA TTGCAAACTA GAGTTAACAT
TGATAGATGA GCTCTTAGGT TACCAACTTT CATGTTATAT GGTTTCTGTA TGACAATACC TTAAGGACGC TGCCTAATTT
ATTTTGTTTC TTTCTGTCTC AGGGTACTGC AGATGCTGTG CGACAATACT TATGGCTATT TGAGGAACAC AATGTTATGG
AGTTTCTCAT TTTGGCTGGA GATCACCTGT ACCGTATGGA CTACCAAAAG TTCATTCAGG CCCACAGAGA AACAAATGCT
GATATAACCG TTGCTGCGCT GCCCATGGAT GAAGAACGTG CTACAGCATT TGGCCTTATG AAGATTGATG ATGAAGGGAG
GATCATTGAA TTTGCAGAAA AGCCAAAAGG AGAGAAGTTG AAATCAATGA TGGTAATTGA TGAGTCATCC GTTGAGACCA
TATGCAACCT GATCTGTTGA AGCATACATT TCAGTGATTG TCTGCATGTT TTGATCTTGC AGGTTGACAC TACCATACTT
GGCCTTGATA CTGAGAGGGC AAAGGAATTG CCTTACATTG CTAGTATGGG AATCTATGTT TTTAGCAAAG ATGTGATGCT
TAAGCTTCTC CGTCAAAATT TCCCTGCTGC AAATGACTTT GGAAGCGAGG TTATTCCTGG AGCAACAGAA ATTGGAATGA
GGGTACGCTA TGCTCTTGAA ACTTGTAGCA TGTAGGGAAT TTTTATCCTT CTCTCAGTTC ATGCTGTAGG TTTTGTGAAG
TTTGGTATGT AAACTGCAGT TACATCATTT ATTGTGAAAT GTTACTTCTT TACTTAATTT TTACTTTGCA TGTTTGCTTA
TGCTGCTAAT GTATTTGATA GGTGCAAGCT TACTTATATG ATGGTTACTG GGAAGATATT GGTACTATAG AGGCATTCTA
CAATGCCAAC TTGGGGATAA CCAAGAAACC TGTGCCAGAT TTTAGGTAAG GTTTACATTT TGCATGGTGA AAACAAGTTA
CTTTTAAAAG GGTGCATTTC TGCTGAATTT TCTTCCTATT TTTGAGCAAA CATTATTGTG TGCAGCTTCT ATGACCGTTC
TGCCGCAATT TATACGCAAC CTCGATACTT GCCTCCATCA AAAGTTCTTG ATGCTGATGT GACAGACAGT GTTATTGGTG
AAGGTTGTGT TATTAGAGTA AGTATCCTTT TCAGATGAAT TATCATAGCG CTTCCTTCTA TGATCTGTGG ATAGTATTAG
ATCATAACAT ATTAGGACCT TGAGTTATTA CTTGTTAGTC GAACATTTCT TTTTCATTGC TTCAAAACAG AGACCCTAAA
TTTGTTGACA TGCCTTTCCC CCTTTATTTT GGCTAGCATT GCACAATCAA CCATTCTGTG GTTGGACTCC GGTCCTGTAT
ATCTGAAGGC GCAGTGATAG AGGACTCTCT GCTAATGGGT GCAGACTATT ATGAGGTAAA ATAAAACAAA ACTATACTAT
ATTATGGTGT ATTGGTGTTG TGGGAACTTA ATTGTGCTTT TTGTTCAGAC GGAGACGGAC AAGAAAGCCC TTTCTGAGAC
TGGTGGCATT CCCATTGGTA TTGGAAAGAA TGCACACATC AGAAAAGCAA TAATTGACAA GAATGCTCGT ATTGGAGAAA
ATGTTAAGGT ATTTCATATA TATTTATACT TTTGGTTGTC AATCTGATGA AGTGTGCCTT CTGTATTAAC TGATCAACTA
TTCATTACTT GAAAGAAAAG AGAGGGACAA GCATATTTGT TTGAATACAA ACTTGGTACT TTCTCATGCT TTTTGTTAAA
GGTGGCCTTT TGCAAATGTG CATCTTGCAT CACTGGTTTG AAAGCCCTTT ATCATTAAAA AATACTACTA TGTCATCATA
CTTTTTCCCC CTAAATTATC TTTCTTTTCA AATGCTATAT GTCTTTTCTT GCCATGGGTT TTTGCCTTGT TGAGTATGGA
TCTTTAATTA TTTACTTACT AAGCACAAAC TGAAAAAATC CAGGCAACCC ATATGGATCG ATTTACATAT TGTTTCTCTC
ACTTTTCCAG AGATGACCAG TTGATACTGA ACTGAACAAA ATGATGTGCA ATGTTTATTG CATTAATTAA TGATCAATCT
TATATGATCT GTTGCTTGTA CAGATAATCA ATGTCGACAA TATCCAAGAA GCTTCAAGGG AGACTGATGG ATACTTCATC
AAAAGTGGCA TTGTCACTGT GATCAAGGAC GCCTTAATCC CTAGCGGAAC AGTCATATAA AGGCAACCAA TCACCACTGT
ACATAAGGTT CTCTCAAATT CTCATATTTA TTCTATTTAG AGCGTTTGGA CATCACCAAT TCACCATGAA ATGGGAAGCG
TCTTTTATTT TCCCTCTTAC AAACAATTTC TACCAAAATT GGATCGACTG CCTTGCTTAA TGCTAGAATT TGCTTAGTAG
CTGGTAAGCC TCATATTTAT GCTTAAATAA GTGATTCTTT TGTTCTGTAA TGCAGGTTGG GCCTTGCAGC ATATGGTGAT
CTGATCTCCA GTGCACATCA AGCAATCAAC TTTTAACGCT GTGGTTTATT CCATGCTGCC AGTTCACCAA GCTCTGCATC
AACTTGCAAG GATATCAT

Locus: Os09g0298200

Loading...

Locus: Os09g0298200

Loading...