Os09t0299000-01

Locus

Os09g0299000

Description

Similar to CDPK substrate protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PHL3

CGSNL Gene Name

PHR1 LIKE 3

Oryzabase Gene Symbol Synonym(s)

OsPHL3

Oryzabase Gene Name Synonym(s)

PHR1 like3, PHOSPHATE STARVATION RESPONSE 1-like 3

Transcript Evidence

AK069336 (DDBJ, Best hit)

Protein Evidence

B6TTD2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Myb-like DNA-binding domain, SHAQKYF class (IPR006447)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Myb, DNA-binding (IPR014778)

Transcription regulator HTH, Myb-type, DNA-binding (IPR017930)

Full-length cDNA

J023010K22 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0299000-01)

RiceXPro (AK069336)

Others

Oryzabase (22585)

KEGG (Os09t0299000-01)

Transcript

2703 bp

>Os09t0299000-01 Similar to CDPK substrate protein 1.
AGATTATACTACAACCCTCCAATCTATAAACACAGAAGTTGAAGAGAGAGAAAGAAGCAA
TAGAGGAGAGAGAAGAGAAGAGGTCAAGAAGAGAAGCAAGAGGAGAGAGGAGAATCGCTG
CCTCTGCCACTGGAAAGCAGCAGCAGCAGGGGAGAGGCAGCAGGCAGCAGCAGAGGAGAA
GCAAGAAGCAAGAAAGAGAGAGAAAGCGTTGGGACTTTTCATTGGATCCTCCGCTTTTGG
GAGGAGCAGCAAAGGTCTCGTCTTTCCTCTCTTCTTCTCTTCCTTGTTGCCGGCGAGGAG
GAAGAAGAAAGAGGAGGAGATGTTCCCGCCTGGGCTGATCCACCACCGGCCGGACGGCGG
CGAGGCGGGGCGTGCGGCGGGGGGAGGGCCCAGCCTGGTGCTGACCGCCGATCCCAAGCC
CCGCCTCCGGTGGACGGCCGACCTCCACGAGCGCTTCGTCGACGCCGTCGCCCAGCTCGG
CGGCCCCGAGAAAGCAACACCTAAAACTATCTTGAGGACAATGGGTGTGAAGGGGCTCAC
TCTTTTCCACTTGAAGAGTCATCTTCAGAAATATAGACTGGGGAAACAATCTGGAAAAGA
GGCATCGGAGCAATCTAAAGATGGTAAGTTACACAAAGCAATCTACTGACCTCACTGTTA
ATTTCGATTAATATTCCAACTTCCAAGTCTTGCTGCAACAATTCCAATTTGTTCACATTG
TGGAAGTTCATTCTGAAGTCATGCAACTATCCTACCATTGATCTGTGGACATGTTAAATA
CGGCTCTGCTCATGAACTGGTGTCTTATGAAGTTGGTTGATCATCGATTGCAATTTGATC
AATATTGATGTATTGCAAGGAATCACTATGTAGCTAACTTCTTGAAAAGATTGGAGATTG
CTTGAAGTTATATGATTTGGAGATGGTAGCTTGGGTTTACTGGTGTTAAGTTTGGATGCA
TCTTGGGAGGAATCAATTGGTAGCAACTTCTTAAAAGACCAGGGATTGCTGGAAATCGTA
TGGATTGGAGATGGCAGCTATGTTAACAGTGTTATGAATTTCCTTTAAGCTTACCATAAA
TCTCTGTTCTGGGGCACCAGTCTGTAGGGACATGAAGGAATAGAGTGGACCTGATGTGGG
AAATAATGGGAGGATTCGTAGTTGAGTGGTCTGCAGGCAACCAAGGACTGAATGGTGAGA
GGGAATCTGTATGTGGAGGAGTATTTTACGTCAGTGGACAAGCTTTTCTTTTTCAgggac
tagctatatttttgacttcacatttttcaccataaaatagtcaattgttttttacattgt
aaattacatatatttacactgtattacacaaatttacactgtagttttcaaaacttacat
tgtaaattccaatatttacaccataatttttatataggatttacagtgtaGTAGAAGCAA
ACCAGAAATCGACTGATAGGTAAACACCCATGTACCTGCAAAACTAGCACTAACAGGTGC
GCTGTGTACAAATACCAAAGACTCCATGCATAAAAAACTGACTGAAATCTATCAATATTT
GTGTCGCCACAAATATAGCGATTCCATATGGGTATATGCAAATTCGTAGTGGCACACATG
CTGATCCAGAAGCTATAGGTCCTGTCCAGTAGGGAGAATTTGTGGGTTGTACTTTTGCCT
TGTGTAGAAAAAGTTCAGTCTTGAGTTAAATTTAGCCCCAGTAATAATTGCATATTGCTA
AGTAGGAGTACTAACATGAATAATCACATCAAGGTTCATCAGTGGGAAATGGAAGAGAAA
TTATACACAAAATGTTGGCAATATTAAGCGTAGTGTTGGTACATGTATCGTTGAATTGCA
GTTTATTGTAATTGTTTCAAATGGAAACGTTTGTAGATTGAATTTGCTCATCTAGTCAAA
TTCTGGACTTTGTTATGCAGATATGTCTTTTTGACTTGAAAACCACACTTTTAAGAGTTC
TTTTGACCTTTTACTAACCTCTGACCTCTGCTATGGTTTGCAGCATCCTATCTTCTAGAT
GCCCAAGGTGGAATGAGTGTGTCGCCTAGAGTTTCTACTCAAGATGTTAAAGAAAATCAA
GAGGTCAAGGAAGCATTGCGAGCTCAGATGGAAATGCAACGAAGACTGCATGAACAAGTG
GAGGTCCAGAAGCATGTGCAGATCAGAATGGAAGCCTACCAGAAGTACATCGACACTTTA
CTAGAGAAGGCATGCAAGATCGTCTCCGAGCAGCTTGCCTCAAGCGGCTTCAGCATCTCG
GACAATGATCTCCCGGAGCTCTCTGGTGGTGTCATGTGCGGCTCCGCTGACACATTGAGC
TCCTCCATCTTCCACCAGCTCTCTGTCAGCCCAATCAACCTGCATAGTCCTGAGGGCAAG
CCGACGCCCTCGGGCATCGAAGGCCAAATGATCCTCCAGAAGTCACCTGAGCTTAAGCGC
AAGTCTTGCTGAGCCGTGTCGTTCGACGCAATCTGGATGTGCAAACACCAGTTTTCTTGT
CATGGGGGTAGTCATGTCGAATTTCGGAATTCGAATTTCGGTAAGAAGGGGGGATGCTCT
GCCAATCTTGTAGAGGCCATCTTGTTCTCTGGCTAATGCATGCCAACATTGTCAAGTAGC
AAGGTTTTCTCTCTTATGTTATCAATCCAATCAGCATATCTTATATAAAATGCCTAATGT
GCT

CDS

330 bp

>Os09t0299000-01 Similar to CDPK substrate protein 1.
ATGTTCCCGCCTGGGCTGATCCACCACCGGCCGGACGGCGGCGAGGCGGGGCGTGCGGCG
GGGGGAGGGCCCAGCCTGGTGCTGACCGCCGATCCCAAGCCCCGCCTCCGGTGGACGGCC
GACCTCCACGAGCGCTTCGTCGACGCCGTCGCCCAGCTCGGCGGCCCCGAGAAAGCAACA
CCTAAAACTATCTTGAGGACAATGGGTGTGAAGGGGCTCACTCTTTTCCACTTGAAGAGT
CATCTTCAGAAATATAGACTGGGGAAACAATCTGGAAAAGAGGCATCGGAGCAATCTAAA
GATGGTAAGTTACACAAAGCAATCTACTGA

Protein

110 aa

>Os09t0299000-01 Similar to CDPK substrate protein 1.
MFPPGLIHHRPDGGEAGRAAGGGPSLVLTADPKPRLRWTADLHERFVDAVAQLGGPEKAT
PKTILRTMGVKGLTLFHLKSHLQKYRLGKQSGKEASEQSKDGKLHKAIY*

5'UTR

chr09:7316075..7316393 (+ strand) : 319 bp

CDS

chr09:7316394..7316565 (+ strand) : 172 bp

chr09:7319399..7319475 (+ strand) : 77 bp

chr09:7319549..7319629 (+ strand) : 81 bp

3'UTR

chr09:7319630..7321073 (+ strand) : 1444 bp

chr09:7321201..7321270 (+ strand) : 70 bp

chr09:7321668..7322207 (+ strand) : 540 bp

FASTA

>Os09t0299000-01 class=Sequence position=chr09:7316075..7322207 (+ strand)
AGATTATACT ACAACCCTCC AATCTATAAA CACAGAAGTT GAAGAGAGAG AAAGAAGCAA TAGAGGAGAG AGAAGAGAAG
AGGTCAAGAA GAGAAGCAAG AGGAGAGAGG AGAATCGCTG CCTCTGCCAC TGGAAAGCAG CAGCAGCAGG GGAGAGGCAG
CAGGCAGCAG CAGAGGAGAA GCAAGAAGCA AGAAAGAGAG AGAAAGCGTT GGGACTTTTC ATTGGATCCT CCGCTTTTGG
GAGGAGCAGC AAAGGTCTCG TCTTTCCTCT CTTCTTCTCT TCCTTGTTGC CGGCGAGGAG GAAGAAGAAA GAGGAGGAGA
TGTTCCCGCC TGGGCTGATC CACCACCGGC CGGACGGCGG CGAGGCGGGG CGTGCGGCGG GGGGAGGGCC CAGCCTGGTG
CTGACCGCCG ATCCCAAGCC CCGCCTCCGG TGGACGGCCG ACCTCCACGA GCGCTTCGTC GACGCCGTCG CCCAGCTCGG
CGGCCCCGAG AGTGAGATTT CCCCCTTGCT TCTCTCCCCC CCATTCTCTC CGATCTCCGG TAGCTTAGCT CCCCCATTGG
AGAGGCGGCG CATTGGCGTT GCGCTTGCGC GGTTGGTTGG TGGGTGGGTG GGTTGCTCCT TCGTTCTTGG TGGTGGTGGT
GGTGGTTCGC GCCAAAGCTC GGATTGGGAG CGGAGATTTC GGCGCGGGAT TTGGGGGGCA TTGTTTTGTT TGTTCGGAGA
TTCAGGAAAT GCTTTGGATC TTTTCGTTTG GTTATAATAA GTCTTCGATT TTGGCAAGGA GAGAAATGCC CGCTTGGCCA
GCGCTTAGGG AAGCGGATTT AGCCCGCTCT AGGCTGGTTT TGGTGTGATT TGGAGGGGAA ACTTGTACCC ATTAGTTGTT
TACAAATTAC AAGTTTGGGG AGTTTACTGA TTGGAGGTGA AAAATCGAGG TCGGCTACTG ATTTGAGCTG CTTGCTTGTC
CTGTACTTTA ACGAATTCTG CACCGGTAGC AATCAAGAGT GTTTTGTTAA TACGAAATTG GTGGTGGTTT CGGGTGTTAG
AATTGGGACA AGGATGAGGG AGAAGTTTCT GCTCATTTTG GGTTTATTTC AGTGGTTTGT AAGTGAACGC AGTGGGATAA
ATACAGCGAT TTCGCAATTT CCCACATGAT GAGGTGCAGT ATCTCACATT GGCACAGGCA TAGAGCAGAT CAGTATTTGG
AGAAAATGGC TCAttcggtt taaaggattt tcataggatt attgtaggaa ttgaatcctt aggaattttt cctatatgca
tcattcgttt cataggaatg gatcctacca aattcctaag gattgtagtc tttcaagcta attctgtagg attcttagca
tgaggtgaga cctcttaact ttacctATTC CTTTGATTTG GAATTCCTAT GAACCGAATA AGCCCTAAGG TAGCGGCTTG
ATTGTTGCCA CCAACACGGT TCACCTGCTA TGCTTAGTAC TTCAGAAAGA CATCTGCCTA GCTTGCATAG GTGTGCAACT
CCCGCCTCAC CTGTATAGCC AATCGTTCCA CCTAGAGCCA CCTGATTGGT GATTAGGCGT TAGGCGCTTG CCACCGTATA
TAATCAACCT AGAGTATGCA TTGAATGTTT TATCATATAA TCATGTTTTT GGTGGCAAAG GGTATTCAGA AGCAGAAGTT
ATAAAGGATT GATTACTCTA GCATCTGATG TATGAATCTT GGTTCAACAC GTAACCATGG AGCTGTTTGC ACTAGTGAAC
AGTAATCCCT GCACACATCA TATTTTTAAC CTGACTATAT TACATAGTTG ACTGATAGGG TTTGTGCATA AGTTTTTCGT
TCATGTTTGA ATTTTGTGAG ATGGGTGCTA TGCATTGTCT GTGCTAGTCT ATGCCTAAAA CTTTGTAATG ACTAATCACT
AATGGTTGAT GCATGACTTA TGCAGAGGCC GGAATAAAGG CATTCATTTA TCTTAAAAAC AACATAGTTG TTCAAAGATG
ATACTGTTTG ATTTTTCTTG GGCGCAGTCT AGGCATTTTT GGTGTATTTC TTAGAATCTG GTGCTTACAT GCCAAAATGC
TTAACTTATG GTATAGAGCT ATAATAGTTC TATACTGATT TAGTTTAGCT TGATGCTTTG ATTTTAGTGG ACTGTGGTGT
CTGCAAGAAG TCTTTGATTC AATCATTAAA ATTTATTAAG GACATACAGT GAATAGAAGT GGCTGTATTT TTCTCCTTTG
AGGTCTTACT CAATTTTGTT GACATGAGTT TAGTTCAATT TACTACTGTC AATTTTCTTG GGACTTGTTT CAAATTTCac
agaactatgc aaatttacat atttaagcca caatatcacc aaactataga tttaacacca aatttatcac aaaTTTTGGC
CTGTAGTTTT CTGTAATTTA CTCTATTTTC TTTATAAAAA TTCAAGGATT CACTTTTACC TTTAGGTTCT AATTATTTTG
ATGAACCATT TAAATCTCAG ACCAACATTA CAAGTGCTTC TGTGATTACT ACCTCCGTCC ATAAAAGGCC TTAGTTTTAG
CTATGCACCT GGACAACTGT CTATACAAAG AAAAGCGTGT ATTGTACTGT TCCTTATTTT CTTGTAGGAG GTATAATCAG
TAGCACAGCG AAACTCACAC TAGATCAAAA TTCTAAATCT TAATTGAATC ATGTAGGTAG TCTAAAAAAG GTTGTGCCTG
TGGCTTTGTG CACCTTCTAG TGCAGTCCCT GGGACAATTA TTCCATTATC TAAAAAAAGT AAATGTTGGC ACTCTAAATT
GCTGGTGCAG TGCCTGGGAT AATTATTCCA TTATCTAAAA AAAGTAAATG TTGGCACTCT AAATTGCTGG TTTATCATTA
GTCAATTGCT AAGGGAATCA AGAtggattt tttttacatt ttagaccttt ctaaaaactt attttacaaa tagaccccta
aaaaacttat tccaggaata gacccttttc gcgacaccaa tgtcattggc gccgtggtcc aacATAATGA TGCCAAAGAT
ATTACCGCCG TCCCCCTTTA CATTAGTGAG TTAGCTTCTG TGGGGATGCT agggggacgg tgccaatgtc attggcgcca
tcatgttgga ctacagcgtc aatgatgttg gcaccgcaaa aagggtctat tcctggagta agtttttttt ggggtctatt
tgtaaaataa gtttcccaaa aggtctaaaa tgtgaaaaat ccagGGGAAT CCAGTAAAAC AGTTTAAGAT TTGATTTCAT
TATATATTTT TAAATTGAGT ACTCAATGCA TGATTATCTT GCAGAAGCAA CACCTAAAAC TATCTTGAGG ACAATGGGTG
TGAAGGGGCT CACTCTTTTC CACTTGAAGA GTCATCTTCA GGTAATTCAT AATACTTTTG CATGTCTTGC AAAGTTTGAA
ATACAGCTAT TTAAGTTTGA TCTTCCTCGA CCAGAAATAT AGACTGGGGA AACAATCTGG AAAAGAGGCA TCGGAGCAAT
CTAAAGATGG TAAGTTACAC AAAGCAATCT ACTGACCTCA CTGTTAATTT CGATTAATAT TCCAACTTCC AAGTCTTGCT
GCAACAATTC CAATTTGTTC ACATTGTGGA AGTTCATTCT GAAGTCATGC AACTATCCTA CCATTGATCT GTGGACATGT
TAAATACGGC TCTGCTCATG AACTGGTGTC TTATGAAGTT GGTTGATCAT CGATTGCAAT TTGATCAATA TTGATGTATT
GCAAGGAATC ACTATGTAGC TAACTTCTTG AAAAGATTGG AGATTGCTTG AAGTTATATG ATTTGGAGAT GGTAGCTTGG
GTTTACTGGT GTTAAGTTTG GATGCATCTT GGGAGGAATC AATTGGTAGC AACTTCTTAA AAGACCAGGG ATTGCTGGAA
ATCGTATGGA TTGGAGATGG CAGCTATGTT AACAGTGTTA TGAATTTCCT TTAAGCTTAC CATAAATCTC TGTTCTGGGG
CACCAGTCTG TAGGGACATG AAGGAATAGA GTGGACCTGA TGTGGGAAAT AATGGGAGGA TTCGTAGTTG AGTGGTCTGC
AGGCAACCAA GGACTGAATG GTGAGAGGGA ATCTGTATGT GGAGGAGTAT TTTACGTCAG TGGACAAGCT TTTCTTTTTC
Agggactagc tatatttttg acttcacatt tttcaccata aaatagtcaa ttgtttttta cattgtaaat tacatatatt
tacactgtat tacacaaatt tacactgtag ttttcaaaac ttacattgta aattccaata tttacaccat aatttttata
taggatttac agtgtaGTAG AAGCAAACCA GAAATCGACT GATAGGTAAA CACCCATGTA CCTGCAAAAC TAGCACTAAC
AGGTGCGCTG TGTACAAATA CCAAAGACTC CATGCATAAA AAACTGACTG AAATCTATCA ATATTTGTGT CGCCACAAAT
ATAGCGATTC CATATGGGTA TATGCAAATT CGTAGTGGCA CACATGCTGA TCCAGAAGCT ATAGGTCCTG TCCAGTAGGG
AGAATTTGTG GGTTGTACTT TTGCCTTGTG TAGAAAAAGT TCAGTCTTGA GTTAAATTTA GCCCCAGTAA TAATTGCATA
TTGCTAAGTA GGAGTACTAA CATGAATAAT CACATCAAGG TTCATCAGTG GGAAATGGAA GAGAAATTAT ACACAAAATG
TTGGCAATAT TAAGCGTAGT GTTGGTACAT GTATCGTTGA ATTGCAGTTT ATTGTAATTG TTTCAAATGG AAACGTTTGT
AGATTGAATT TGCTCATCTA GTCAAATTCT GGACTTTGTT ATGCAGATAT GTCTTTTTGA CTTGAAAACC ACACTTTTAA
GAGTTCTTTT GACCTTTTAC TAACCTCTGA CCTCTGCTAT GGTTTGCAGC ATCCTATCTT CTAGATGCCC AAGGTGGAAT
GAGTGTGTCG CCTAGAGTTT CTACTCAAGA TGTTAAAGAG TAAGCTCCAT GGGATACTCA TCCTGGACAT TTGTTTCTCC
ATTCTGGCAA ATACGAATAT TTTAATAATA GTGCTCGTGT TGTGCTAGTT TAAAAAGAGT TAAAATGTCA CATGTACTTG
TTACAGAAAT CAAGAGGTCA AGGAAGCATT GCGAGCTCAG ATGGAAATGC AACGAAGACT GCATGAACAA GTGGAGGTAA
CTTTGAAAGC TTGATCCGTC ATAATATTCT TTGGTTTTTA TACATGCCAT TAGCAAGAAA GAAGAGCTAG TGCTCACCAA
CTTCAGTATT TGCTACATAA GAATAAAGCC CTCAAGCTTT AAAACAAATG ATATACCGTG AGGCTGATAC TTCACCAATA
TTCAGAACAG CCGGTCCTTC AGGATTTGTG CGCTGCATCT CGTGTTACCG AAAAATGTGG AACACACTTG TTCATTATCA
TTTCTACAAC TGCACTTTTA ACACTTAGCA TGCCACACAA TATGTCAACA TGAAAAGCTC TATTGAAGAT CTGTTAGTTT
TAAGATTTTC ATTGTAATCA GGAATACATT GTCCAACACA CAATAGTTGA CTATTTCATT TTCCCATGAT CAGGTCCAGA
AGCATGTGCA GATCAGAATG GAAGCCTACC AGAAGTACAT CGACACTTTA CTAGAGAAGG CATGCAAGAT CGTCTCCGAG
CAGCTTGCCT CAAGCGGCTT CAGCATCTCG GACAATGATC TCCCGGAGCT CTCTGGTGGT GTCATGTGCG GCTCCGCTGA
CACATTGAGC TCCTCCATCT TCCACCAGCT CTCTGTCAGC CCAATCAACC TGCATAGTCC TGAGGGCAAG CCGACGCCCT
CGGGCATCGA AGGCCAAATG ATCCTCCAGA AGTCACCTGA GCTTAAGCGC AAGTCTTGCT GAGCCGTGTC GTTCGACGCA
ATCTGGATGT GCAAACACCA GTTTTCTTGT CATGGGGGTA GTCATGTCGA ATTTCGGAAT TCGAATTTCG GTAAGAAGGG
GGGATGCTCT GCCAATCTTG TAGAGGCCAT CTTGTTCTCT GGCTAATGCA TGCCAACATT GTCAAGTAGC AAGGTTTTCT
CTCTTATGTT ATCAATCCAA TCAGCATATC TTATATAAAA TGCCTAATGT GCT

Locus: Os09g0299000

Loading...

Locus: Os09g0299000

Loading...