Os09t0323000-01

Locus

Os09g0323000

Description

Similar to UDP-galactose 4-epimerase-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UGE4

CGSNL Gene Name

UDP-GLUCOSE EPIMERASE 4

Oryzabase Gene Symbol Synonym(s)

OsUGE4, OsUGE3

Oryzabase Gene Name Synonym(s)

UDP-glucose epimerase 4

Transcript Evidence

AK121426 (DDBJ, Best hit)

Protein Evidence

Q58IJ5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: galactose metabolic process (GO:0006012)

Biological Process: cellular metabolic process (GO:0044237)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)

Molecular Function: coenzyme binding (GO:0050662)

Functional domain (InterPro)

NAD-dependent epimerase/dehydratase (IPR001509)

UDP-glucose 4-epimerase (IPR005886)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023135L03 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0323000-01)

RiceXPro (AK121426)

Others

Oryzabase (12413)

KEGG (Os09t0323000-01 (EC:5.1.3.2, EC:5.1.3.3))

Transcript

1418 bp

>Os09t0323000-01 Similar to UDP-galactose 4-epimerase-like protein.
GAAGGTCGAAGCAGATCCACTCGCGCGCTCGCGAGGGTGCGTCGCGAGCGGGAGGTcaga
gaagggggatcggccgatcgatcgatggcggggggcgaggtggtggcggtggcggcggcg
gcggcggggacgagcaggacggtgctggtgACGGGAGGGGCCGGGTACATCGGGAGCCAC
ACCGTGCTGCAGCTGCTCGCCGCGGGGTTCCGCGTCGTCGTCGCCGACAGCCTCGGGAAC
TCCTCCGAGCTCGCCGTCCGCCGCGTCGCCGCGCTCGCCGGGGACAAGGCGCGGAACCTC
TCCTTACACAAGGTTGATATTCGTGATAAGGGTGGACTGGAAAAGGTTTTTTCTTCGACA
AGATTTGATGCTGTCGTTCATTTTGCTGGTCTGAAAGCTGTGGGTGAAAGTGTGCAGAAG
CCATTGCTTTATTATGACCATAATGTTGCTGGGACAATAATTCTTCTAGAAGTTATGGCA
GCCCATGGATGTAAAAAGTTGGTGTTTTCATCGTCAGCTGCAGTTTATGGATCACCTAAA
AACTCACCCTGCACAGAAGAGTTTCCTCTCACTCCACACAATCCATATGGCAGAACCAAG
CTCATAGCAGAGGAGATTTGCCGTGATATATACCATTCAGATTCTGAATGGAGCATAATT
TTACTTAGGTACTTCAATCCTGTTGGAGCTCATCCCAGTGGATACCTTGGTGAAGACCCA
TGTGGAATTCCTAACAACCTCATGCCCTTCGTCCAGCAAGTTGCTGTCGGGAGGAGACCG
TCACTTACAATATTTGGAAATGACTATGCAACAAAAGATGGGACAGGGGTACGTGATTAT
ATTCATGTAGTTGATCTTGCTGAGGGGCATATTGCTGCACTACGGAAGCTGTTTGAAAGC
TCAATAGGATGTCAAGCATACAACCTTGGAACAGGAAAGGGAACATCAGTGTTGGAAATA
GTTAATGCATTTGAGAAAGTTTCTGGAAAGAAAATACCTTTGGTTATTGGTCCACGACGC
CCTGGTGATGCTGAGATTCTCTTTTCGTCAGCTGCTAAAGCAGAGAGAGAATTCAAGTGG
AAGGCAAAATATGGCATCGAAGAAATGTGCAGAGACCAATGGAACTGGGCGAGCAAGAAT
CCTTTCGGGTACGCCTCGCCCGACTCCACCAAGCAGAATGGTCATTCACACTGATCAACG
CCGATTGGTCTGTGTGAACTCAGTTGTACATGCAACGTAGAACTACAGGTCGAGATCGAT
GTAGATCTAGTCGGTCAGTCATACAGAGAAAGCTTAGAAAAGATTTGTTCTCTTCTTTTG
GACCAGTATTGGTATAAATCTACCCTTCTGCATATAGTTCAAAATTGTTGTAGGAACATT
GCTATAGTCAGTCAGCTAATTCAATTCTTTTTCTTGCT

CDS

1110 bp

>Os09t0323000-01 Similar to UDP-galactose 4-epimerase-like protein.
atggcggggggcgaggtggtggcggtggcggcggcggcggcggggacgagcaggacggtg
ctggtgACGGGAGGGGCCGGGTACATCGGGAGCCACACCGTGCTGCAGCTGCTCGCCGCG
GGGTTCCGCGTCGTCGTCGCCGACAGCCTCGGGAACTCCTCCGAGCTCGCCGTCCGCCGC
GTCGCCGCGCTCGCCGGGGACAAGGCGCGGAACCTCTCCTTACACAAGGTTGATATTCGT
GATAAGGGTGGACTGGAAAAGGTTTTTTCTTCGACAAGATTTGATGCTGTCGTTCATTTT
GCTGGTCTGAAAGCTGTGGGTGAAAGTGTGCAGAAGCCATTGCTTTATTATGACCATAAT
GTTGCTGGGACAATAATTCTTCTAGAAGTTATGGCAGCCCATGGATGTAAAAAGTTGGTG
TTTTCATCGTCAGCTGCAGTTTATGGATCACCTAAAAACTCACCCTGCACAGAAGAGTTT
CCTCTCACTCCACACAATCCATATGGCAGAACCAAGCTCATAGCAGAGGAGATTTGCCGT
GATATATACCATTCAGATTCTGAATGGAGCATAATTTTACTTAGGTACTTCAATCCTGTT
GGAGCTCATCCCAGTGGATACCTTGGTGAAGACCCATGTGGAATTCCTAACAACCTCATG
CCCTTCGTCCAGCAAGTTGCTGTCGGGAGGAGACCGTCACTTACAATATTTGGAAATGAC
TATGCAACAAAAGATGGGACAGGGGTACGTGATTATATTCATGTAGTTGATCTTGCTGAG
GGGCATATTGCTGCACTACGGAAGCTGTTTGAAAGCTCAATAGGATGTCAAGCATACAAC
CTTGGAACAGGAAAGGGAACATCAGTGTTGGAAATAGTTAATGCATTTGAGAAAGTTTCT
GGAAAGAAAATACCTTTGGTTATTGGTCCACGACGCCCTGGTGATGCTGAGATTCTCTTT
TCGTCAGCTGCTAAAGCAGAGAGAGAATTCAAGTGGAAGGCAAAATATGGCATCGAAGAA
ATGTGCAGAGACCAATGGAACTGGGCGAGCAAGAATCCTTTCGGGTACGCCTCGCCCGAC
TCCACCAAGCAGAATGGTCATTCACACTGA

Protein

370 aa

>Os09t0323000-01 Similar to UDP-galactose 4-epimerase-like protein.
MAGGEVVAVAAAAAGTSRTVLVTGGAGYIGSHTVLQLLAAGFRVVVADSLGNSSELAVRR
VAALAGDKARNLSLHKVDIRDKGGLEKVFSSTRFDAVVHFAGLKAVGESVQKPLLYYDHN
VAGTIILLEVMAAHGCKKLVFSSSAAVYGSPKNSPCTEEFPLTPHNPYGRTKLIAEEICR
DIYHSDSEWSIILLRYFNPVGAHPSGYLGEDPCGIPNNLMPFVQQVAVGRRPSLTIFGND
YATKDGTGVRDYIHVVDLAEGHIAALRKLFESSIGCQAYNLGTGKGTSVLEIVNAFEKVS
GKKIPLVIGPRRPGDAEILFSSAAKAEREFKWKAKYGIEEMCRDQWNWASKNPFGYASPD
STKQNGHSH*

5'UTR

chr09:9442470..9442553 (- strand) : 84 bp

CDS

chr09:9442242..9442469 (- strand) : 228 bp

chr09:9440835..9440884 (- strand) : 50 bp

chr09:9440570..9440705 (- strand) : 136 bp

chr09:9440047..9440148 (- strand) : 102 bp

chr09:9439739..9439966 (- strand) : 228 bp

chr09:9439032..9439110 (- strand) : 79 bp

chr09:9438744..9438826 (- strand) : 83 bp

chr09:9438211..9438302 (- strand) : 92 bp

chr09:9438014..9438125 (- strand) : 112 bp

3'UTR

chr09:9437790..9438013 (- strand) : 224 bp

FASTA

>Os09t0323000-01 class=Sequence position=chr09:9437790..9442553 (- strand)
GAAGGTCGAA GCAGATCCAC TCGCGCGCTC GCGAGGGTGC GTCGCGAGCG GGAGGTcaga gaagggggat cggccgatcg
atcgatggcg gggggcgagg tggtggcggt ggcggcggcg gcggcgggga cgagcaggac ggtgctggtg ACGGGAGGGG
CCGGGTACAT CGGGAGCCAC ACCGTGCTGC AGCTGCTCGC CGCGGGGTTC CGCGTCGTCG TCGCCGACAG CCTCGGGAAC
TCCTCCGAGC TCGCCGTCCG CCGCGTCGCC GCGCTCGCCG GGGACAAGGC GCGGAACCTC TCCTTACACA AGGTTAATAC
TGTCCTGACT CCTGAGGCGA TGCGCGCAGC GGGGGGTTGG TTGGTTGTTT GTTTCGCGGC TTTTGGCTGC TTGGGTTTGC
GTGATTTTGC GCTTGTTTTT TTTTTTTGGG GGACCAGCAC GATCGGCCGA TGGGGGATTG GGGGCCCGTT CCAATGTTGG
CAGATCTCTC CCGCTGACCT GAGGCCGAGT CATTTGGCCT TTTTTTGGTG ATCATTTTGA TTGTTTAGTG TGTGTAGCAA
GGGTGGGTTA CTCGTCATGG GGGGAAATTT TGGTGTTCTT TTCTTTTTTT TTTCTGTTAT ACTTGGCGTG AATTTGGCCG
AGATCGCTAG TATTTATTTC AGGGTCAAAC AAATGTGAAG TGATTTGGAT TACAGCCGTA TGAGTTGGTT TATCGCCAAG
TGCGGGTATC TATGGTAATT GTATATTAGT GGAATATAAC TGCCGTAAAT TCTCATATTG TGCTGTACGA TCATGAATTT
CGGTCGTTTG CCTTGAGTAT TGATTCGAAG ATGATAATGG AGAAGAGATA TTTCTTTTAT CCAATAGAAA ACCGGAAGAG
ATCTGATCTA AGCATAATGC CATGTGGCTG GACATGTATA CCTGTCTGGT ATCTCATTGT TTTAGGCTAT CCAGTTTGTA
TATTTCGTTC TTGCCAGTTC AATGGGTTGG GTCATGGGTC GTCTATGTAT TGAAACTTAT ATTGAATGAT CTGAAAGATT
TGGATATTTA CTACTGAGCT GTAACTAGGT AAATTAGTGT GTCATTGTTT GTTAAGAATG GCAATTAGTA TAATTTTGAT
TATTCAAGTT TGTACTCTGG GATGAATGGG AATTTTAATA ACATATGTTT AATAGTGGAA CTCACATTTG TGGGGCTAGT
AGATGAGTCT ACTTGCAACT GTCCAATTGG GAAGATCTGC AAGTTGTTGT GCCATTGCCT TCATTGTTTA ACATAATTGT
ATGGCATAGG CATTGCAGTA TCTATACAGT TGGTTCCAGT GACCTTATTT GGTGTTATTG TTATTGCTAT GGACAAAACG
AGTTTGCCAG GCTAGTGCGT TCAATGTTCT GAATTATTTT AGTACTGGCA GTTAAAAAAA AACAATTTCT TGCTCTTCCT
ATCGCACTTG CTAGAATAGG TGTGAGGTTT GGTGCCAGTT GTGTAGAATA TCTCATTTGT CTTCAGATAT GGTTATTTCA
AAGGAATGGG TTAAATACTT TGATGTACAT CTGGAAGTCA ATGCTACATT ATGTATTTAA TCCACTACAT AACCTTGATC
CTACTGAAAA TTTTTGAAAG TCCTTAAGGT ACATTAAATT CAACACTATT AACTTCTCTT CTTCCGCAGG TTGATATTCG
TGATAAGGGT GGACTGGAAA AGGTTTTTTC TTCGACAAGG TAAAACACGC TATAAAATAG TATTATCTTT TTATTCCTTT
TTACTTCTTT TATACTTTTC AAAAGCAGCA ATTTGTAACA TCTCTGTAAA GTAAAAGTAT CTAAATTCCT AAAATATGTC
TTTTCTAGAT TTGATGCTGT CGTTCATTTT GCTGGTCTGA AAGCTGTGGG TGAAAGTGTG CAGAAGCCAT TGCTTTATTA
TGACCATAAT GTTGCTGGGA CAATAATTCT TCTAGAAGTT ATGGCAGCCC ATGGATGTAA AAAGGTAATT ACCCCTCCCA
TATCTGTGGG CTAGCTTATA CTCCATGAGG ATGTCTTCTA AAGTAATTCC TTTTGATTCA ATGCATCTAT ACAATTTTAA
AATAAAATAT TTGCTTCTCT GCTGTCCAAT CCAATTCATG TTGTAGACTT CATGGGTTTC ATTTACAGTC AACATCATTT
TTTATTTAGT CATTGCTCCA ACTTCTGTAA ATTATAATAA TGAACCGTGC ACCTACTAGG TTACTTACTA GGAATGGTGA
TAGCATCCTT GTTTTTTTAA TACCTGTAGC TGAAAATCAT TCTGTTAATA ATCATGCCAA CTGTCAATGA TTTGTTTTGA
GGTTAAACCA GAGTATCCGT TGCTTTGCTT GTATCAGACT GATGCTGACA TATATTTGTT TTCTCATGTG GTCAAATGTT
TGTAGTTGGT GTTTTCATCG TCAGCTGCAG TTTATGGATC ACCTAAAAAC TCACCCTGCA CAGAAGAGTT TCCTCTCACT
CCACACAATC CATATGGCAG AACCAAGGTG TGCTTATGTC TTTCCCTATA TTTGCAAATG TTTGCACCAA ATGCTTAGCT
GATTGCAATC ATATATATCA ATTGCAGCTC ATAGCAGAGG AGATTTGCCG TGATATATAC CATTCAGATT CTGAATGGAG
CATAATTTTA CTTAGGTACT TCAATCCTGT TGGAGCTCAT CCCAGTGGAT ACCTTGGTGA AGACCCATGT GGAATTCCTA
ACAACCTCAT GCCCTTCGTC CAGCAAGTTG CTGTCGGGAG GAGACCGTCA CTTACAATAT TTGGAAATGA CTATGCAACA
AAAGATGGGA CAGGGGTAAT CTCCTTTGAG ATACATTCAG TTACCTTCTT TACTTTATCT CAACCTCTTC AATTTGAGTA
TTAACCTTTA TATATAGCAT GTACTAGTGA GCCTTGGGTT AGCCGTATTT TTAGAAATAT AACATTCCTG CAAGTAATAA
CCGAACTAAG ATATTTGCAT GACTTGAGGG AAGTAACAAT GTGGCTTATC AGATACCATA TTCAGTGTTG TAAAGCTCCT
TTGCCAGCCC AGGGGAGAAG TGCTGTAAAG TAGTTCTTCC CTTAGAGTCA GTCCTCAGAG CTATAAGATG TCCTACTAAC
AAGCATGTTA CATCATGGTC ATTTCTAGTG TTTCTTATCC TCTTCCATAT GATATAGCTG TGCCACTATA GCATGCTTGA
GAATCCTGAT GGGGAAGAGT AGAAGAGACA TGAAATAAGT AGAAATAAAA AGATTTTCCG TTTAACCTGT TGACAATCTT
CTTTGTGTGG TAGTTTTCCT TTCACATATT ATAGTTTTAT TGACATCGGC TGCATAGACT TATAGACATT ATTCTTCAAA
ATTAGAGCTC TGTAGACTGA CAAGTGCATA TTTTTAGTTG AATATTCTAA TCCATCAAGG AATTCTTTTT GGCATGATTG
CAGGTACGTG ATTATATTCA TGTAGTTGAT CTTGCTGAGG GGCATATTGC TGCACTACGG AAGCTGTTTG AAAGCTCAAT
AGGTTTGCAC AATTTACTGC TCTCTCAACT CAAATTTTTA TGGGCAAATT CTTGCATGCA CCCCTTGCTA TGTGTGTGCA
ATGGTTCCCC AAAACGAGTC TCCGGTGAAT TACAGCACTG TTTAGAACTC AAATAGTGTT GGATGCTCAG AACTGTCACT
TTGTTTTGAT GTTAAATCTT TTTTCTAAAA TTTATTTCTA CTTGCAGGAT GTCAAGCATA CAACCTTGGA ACAGGAAAGG
GAACATCAGT GTTGGAAATA GTTAATGCAT TTGAGAAAGT TTCTGGAAAG GTATGCCTGA TTTGATATAT TTGGACAAGT
GTACATGTTT CTTGCCTGTC CTTTTGACAT GTTATGTTGT GCTGGTTACC AAATTTCCTA CTCAATTCTT CTGACCTGTT
GGTACGCAGG CAATCCTTAG GTTTATTCAC tactccctcc gtttcacaat ataagtcatt ctagcatttt ctatattcat
attgatgcta atgaatctag acatatatat ctatctagag tcattaacat caatacgaat gtggaaaatg ctagaatgac
ttacattgtg aaacggagga agtaTGTTAT TGTAAAGGCA TTACTGCACT AGAGGCCTAG GGACTACAAA GTTGTATGAG
TTCTCACTAA TGCCTATGCA TATGATACAC GAGTGCAATG GATTTTTTTT CGTTGTGCTT TCTTTTCTTA TCCGTATGTT
CCTCTTTTTA GAAAATACCT TTGGTTATTG GTCCACGACG CCCTGGTGAT GCTGAGATTC TCTTTTCGTC AGCTGCTAAA
GCAGAGAGAG AATTCAAGTG GAAGTAAGTT ACACAGTAAC ATTGAGAAGA TGATCATTGA TTGTAAATTT CTAGTTTTTC
TCATGGTTTA GTGTCGATCT TCCTTCAGGG CAAAATATGG CATCGAAGAA ATGTGCAGAG ACCAATGGAA CTGGGCGAGC
AAGAATCCTT TCGGGTACGC CTCGCCCGAC TCCACCAAGC AGAATGGTCA TTCACACTGA TCAACGCCGA TTGGTCTGTG
TGAACTCAGT TGTACATGCA ACGTAGAACT ACAGGTCGAG ATCGATGTAG ATCTAGTCGG TCAGTCATAC AGAGAAAGCT
TAGAAAAGAT TTGTTCTCTT CTTTTGGACC AGTATTGGTA TAAATCTACC CTTCTGCATA TAGTTCAAAA TTGTTGTAGG
AACATTGCTA TAGTCAGTCA GCTAATTCAA TTCTTTTTCT TGCT

Locus: Os09g0323000

Loading...

Locus: Os09g0323000

Loading...