Os09t0323000-02

Locus

Os09g0323000

Description

Similar to UDP-D-glucose epimerase 2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

UGE4

CGSNL Gene Name

UDP-GLUCOSE EPIMERASE 4

Oryzabase Gene Symbol Synonym(s)

OsUGE4, OsUGE3

Oryzabase Gene Name Synonym(s)

UDP-glucose epimerase 4

Transcript Evidence

AK063871 (DDBJ, Best hit)

Protein Evidence

Q58IJ5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: galactose metabolic process (GO:0006012)

Molecular Function: UDP-glucose 4-epimerase activity (GO:0003978)

Functional domain (InterPro)

UDP-glucose 4-epimerase (IPR005886)

Full-length cDNA

001-122-E09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0323000-02)

RiceXPro (AK063871)

Others

Oryzabase (12413)

KEGG (Os09t0323000-02 (EC:5.1.3.2, EC:5.1.3.3))

Transcript

589 bp

>Os09t0323000-02 Similar to UDP-D-glucose epimerase 2.
CAGTGTTGGAAATAGTTAATGCATTTGAGAAAGTTTCTGGAAAGAAAATACCTTTGGTTA
TTGGTCCACGACGCCCTGGTGATGCTGAGATTCTCTTTTCGTCAGCTGCTAAAGCAGAGA
GAGAATTCAAGTGGAAGGCAAAATATGGCATCGAAGAAATGTGCAGAGACCAATGGAACT
GGGCGAGCAAGAATCCTTTCGGGTACGCCTCGCCCGACTCCACCAAGCAGAATGGTCATT
CACACTGATCAACGCCGATTGGTCTGTGTGAACTCAGTTGTACATGCAACGTAGAACTAC
AGGTCGAGATCGATGTAGATCTAGTCGGTCAGTCATACAGAGAAAGCTTAGAAAAGATTT
GTTCTCTTCTTTTGGACCAGTATTGGTATAAATCTACCCTTCTGCATATAGTTCAAAATT
GTTGTAGGAACATTGCTATAGTCAGTCAGCTAATTCAATTCTTTTTCTTGCTAATTTAGT
GGCATTGCCTTGCACAGTACTTGATGCAGATTCCTGCATCACCAAGAATGCAGCTGTATA
CGGATTTTGTATCTGAAATATGAATGGATAGAACCACAGTTATACATTC

CDS

246 bp

>Os09t0323000-02 Similar to UDP-D-glucose epimerase 2.
GTGTTGGAAATAGTTAATGCATTTGAGAAAGTTTCTGGAAAGAAAATACCTTTGGTTATT
GGTCCACGACGCCCTGGTGATGCTGAGATTCTCTTTTCGTCAGCTGCTAAAGCAGAGAGA
GAATTCAAGTGGAAGGCAAAATATGGCATCGAAGAAATGTGCAGAGACCAATGGAACTGG
GCGAGCAAGAATCCTTTCGGGTACGCCTCGCCCGACTCCACCAAGCAGAATGGTCATTCA
CACTGA

Protein

82 aa

>Os09t0323000-02 Similar to UDP-D-glucose epimerase 2.
VLEIVNAFEKVSGKKIPLVIGPRRPGDAEILFSSAAKAEREFKWKAKYGIEEMCRDQWNW
ASKNPFGYASPDSTKQNGHSH*

5'UTR

chr09:9438786..9438787 (- strand) : 2 bp

CDS

chr09:9438744..9438785 (- strand) : 42 bp

chr09:9438211..9438302 (- strand) : 92 bp

chr09:9438014..9438125 (- strand) : 112 bp

3'UTR

chr09:9437673..9438013 (- strand) : 341 bp

FASTA

>Os09t0323000-02 class=Sequence position=chr09:9437673..9438787 (- strand)
CAGTGTTGGA AATAGTTAAT GCATTTGAGA AAGTTTCTGG AAAGGTATGC CTGATTTGAT ATATTTGGAC AAGTGTACAT
GTTTCTTGCC TGTCCTTTTG ACATGTTATG TTGTGCTGGT TACCAAATTT CCTACTCAAT TCTTCTGACC TGTTGGTACG
CAGGCAATCC TTAGGTTTAT TCACtactcc ctccgtttca caatataagt cattctagca ttttctatat tcatattgat
gctaatgaat ctagacatat atatctatct agagtcatta acatcaatac gaatgtggaa aatgctagaa tgacttacat
tgtgaaacgg aggaagtaTG TTATTGTAAA GGCATTACTG CACTAGAGGC CTAGGGACTA CAAAGTTGTA TGAGTTCTCA
CTAATGCCTA TGCATATGAT ACACGAGTGC AATGGATTTT TTTTCGTTGT GCTTTCTTTT CTTATCCGTA TGTTCCTCTT
TTTAGAAAAT ACCTTTGGTT ATTGGTCCAC GACGCCCTGG TGATGCTGAG ATTCTCTTTT CGTCAGCTGC TAAAGCAGAG
AGAGAATTCA AGTGGAAGTA AGTTACACAG TAACATTGAG AAGATGATCA TTGATTGTAA ATTTCTAGTT TTTCTCATGG
TTTAGTGTCG ATCTTCCTTC AGGGCAAAAT ATGGCATCGA AGAAATGTGC AGAGACCAAT GGAACTGGGC GAGCAAGAAT
CCTTTCGGGT ACGCCTCGCC CGACTCCACC AAGCAGAATG GTCATTCACA CTGATCAACG CCGATTGGTC TGTGTGAACT
CAGTTGTACA TGCAACGTAG AACTACAGGT CGAGATCGAT GTAGATCTAG TCGGTCAGTC ATACAGAGAA AGCTTAGAAA
AGATTTGTTC TCTTCTTTTG GACCAGTATT GGTATAAATC TACCCTTCTG CATATAGTTC AAAATTGTTG TAGGAACATT
GCTATAGTCA GTCAGCTAAT TCAATTCTTT TTCTTGCTAA TTTAGTGGCA TTGCCTTGCA CAGTACTTGA TGCAGATTCC
TGCATCACCA AGAATGCAGC TGTATACGGA TTTTGTATCT GAAATATGAA TGGATAGAAC CACAGTTATA CATTC

Locus: Os09g0323000

Loading...

Locus: Os09g0323000

Loading...