Os09t0332300-00

Locus

Os09g0332300

Description

Similar to PDR20.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR21

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 21

Oryzabase Gene Symbol Synonym(s)

OsABCG46, OsPDR21

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 46, pleiotropic drug resistance 21

Transcript Evidence

AK355919 (DDBJ)

Protein Evidence

A3BXL8 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Expression Databases

TENOR (Os09t0332300-00)

Others

Oryzabase (12019)

Transcript

2586 bp

>Os09t0332300-00 Similar to PDR20.
ATGAATATATTGCAAAGATTAATGAAAACAATGCAATCTTGTAGATGTTTTAGACAATTC
CTTGTGCTTTTTGTAATGTCCGAGGCAATATGTGGACTTTTCCGTTTCATTGCTGCTCTT
ACAAGGCATCCAGTTGTTGCAAGCACCGTGAGTGAATTCTGTATACTAATAGTTATGGTT
TCAAGCGGATTCATCCTATCAAGAGATGAAGTTAAAAAATGGCTGATATGGGAGTACTGG
ACATCACCCCTGATGTATGCACTAAATGCCTTAGCAGTAAATGAATTCCTAAGTCCCAGC
TGGAATGAGGCACTACCTGGTTTTAGAGAACCACTTGGAAGGTTAGTTCTGGAATCTCGT
GGGGTTTTCCCGGAGGCCAAATGGTATTGGATTGGTCTTGGTGCCTTGCTTGGATATGTG
CTTCTGTTCAATATCCTCTACACCATCTGCCTCTCAATTCTCACATTACTTAAAAGAAAT
GTGCGAGAAATGTCTCAGGAAACATTGCAGATAAAACTAGAAAATTTAACCGGTTATGAT
CAAGAGCCATCATCTGGAGGCCGAGTTACCAATGATAAAAGATACACTGAGGGTGGCAAC
AATGATGAAGCAACTTCAAGCAATGCAAATCATAATTCTAGTCCAGCCAGGAAAGGAAGT
ATCCTGCCTTTTGTACCCGTTTACATGACATTTGAAGATATAAGATACAGTATAGACATG
CCAAAGGCACTGAAAGTACAGGGTATGGCAGGGAGTCGGTTGGAACTACTGAAGGATCTT
AGTGGTTCATTTAGGCCAGGAGTGCTTACAGCACTTATGGGTATCAGTGGTGCAGGCAAG
ACAACATTGTTGGATGTGTTAGCTGGGAGGAAGACCAGTGGACACATACATGGTAATATT
ACTGTATCTGGCTATCCGAAGAAGCAAGAAACATTTTCTCGAGTTTCAGGATATTGTGAA
CAAAATGATATCCATTCACCAAATCTAACTGTCTATGAATCCCTTATGTTCTCAGCATGG
CTTAGATTACCAGCCGAAATTGATTCTATGGCAAGAAAGAGATTTATTGATGAGTTCATG
GAGCTTGTGGAGCTCTTTCCCTTAAAAGATGCATTGGTTGGATTGCTTGGCTTGAGTGGA
TTATCAACTGAACAAAGGAAACGGCTAACAATAGCAGTGGAACTAGTTGCAAACCCATCT
ATCATATTCATGGATGAACCAACATCTGGACTTGATGCACGAGCAGCAGCCATTGTCATG
AGGACAGTAAGGAATATTGTGGACATGGGAAGAACTGTTGTTTGCACAATCCACCAACCT
AGTATTGATATATTTGAATCATTTGATGAGCTCTTCCTAATGAAAAGAGGAGGTGAAGCA
ATTTATGTAGGTCCATTAGGACAACATTCATGTGAATTGATCAAATATTTTGAGTCTATT
GAAGGTGTCAGGAAGATAAAACATGGCTACAATCCTTCAACATGGATGCTGGAAGTGACT
TGTACATTGCAGGAACAGATAACTGGGGTTAACTTTACTCAAGTATACAAGAATTCTGAA
CTATATAGGAGGAACAAAAATTTGATAAAGGAGTTAAGCACACCCCATGACGGTTCAAGC
GACTTATTGTTTCCAACTAAATATTCACAGACCTTTGTTATACAATGTTTGGCTTGCCTC
TGGAAGCAACGTTTGTCATATTGGAGGAATCCTCCATATATTGCTGTGAATTTCTTCTTC
ACCGTTGTAATTGCACTATTGTTTGGAACAATGTTCTGGGGCGTTGGTAGAAAAAGGCAA
AGTCAACAAGCCTTGCTCAGTGCCATGGGTTCCATGTATTCCACATGTTTCACTCTAGGA
GTGCAGAACTCTTCTTCAGTTCAACCAGTTGTCAATATTGAACGCACGGTCTTTTACAGG
GAAAGAGCATCTCACATGTACTCGCCTTTGCCATATGCCTTGGGGCAGGTTGTAGTTGAA
CTTCCTTACATCTTCCTCCAAACCTTGATATATGGTGTGATAGTGTATTCTATGATGGGA
TACGAGTGGACATGCACCAAGTTTTTTTGGTACATGTTCTTCATGTACTTCACTCTATCA
TACTTCACATTTTATGGCATGATGGCGGCAGGTCTAACTCCAAACTACACCATGTCCTCT
ATTGTTTCCACAACTTTCTATGCCATATGGCACCTTTTCTCTGGATTTCTAATACCAAAA
ACAAGAATTCCAATATGGTGGAGATGGTACTATTGGATTTGCCCTGTTGCATGGACAATC
AATGGGTTGGTTACTTCACAGTTTGGGGATGTAGATGACAAGTTTGATAACGGTGTGCGT
GTATCTGACTTTGTTGAGAGCTACTTTGGTTACAATCTTGACTTGTTATGGGTGGCTGCT
ATGGCCGTTGTGTCATTTGCAATTCTTTTTGCCATCCTTTTCGGATTCTCACTTAAGCTA
TTCAACTTCCAAAAGAGATAATTCATATGTACTAGAGTTTCATAATTTGATTAGCCCGGA
TAAAACACATATTATAATAGAAGATATTTTCAATAATTTTAAAGTATTTAAATAATAGCA
GATAGC

CDS

2481 bp

>Os09t0332300-00 Similar to PDR20.
ATGAATATATTGCAAAGATTAATGAAAACAATGCAATCTTGTAGATGTTTTAGACAATTC
CTTGTGCTTTTTGTAATGTCCGAGGCAATATGTGGACTTTTCCGTTTCATTGCTGCTCTT
ACAAGGCATCCAGTTGTTGCAAGCACCGTGAGTGAATTCTGTATACTAATAGTTATGGTT
TCAAGCGGATTCATCCTATCAAGAGATGAAGTTAAAAAATGGCTGATATGGGAGTACTGG
ACATCACCCCTGATGTATGCACTAAATGCCTTAGCAGTAAATGAATTCCTAAGTCCCAGC
TGGAATGAGGCACTACCTGGTTTTAGAGAACCACTTGGAAGGTTAGTTCTGGAATCTCGT
GGGGTTTTCCCGGAGGCCAAATGGTATTGGATTGGTCTTGGTGCCTTGCTTGGATATGTG
CTTCTGTTCAATATCCTCTACACCATCTGCCTCTCAATTCTCACATTACTTAAAAGAAAT
GTGCGAGAAATGTCTCAGGAAACATTGCAGATAAAACTAGAAAATTTAACCGGTTATGAT
CAAGAGCCATCATCTGGAGGCCGAGTTACCAATGATAAAAGATACACTGAGGGTGGCAAC
AATGATGAAGCAACTTCAAGCAATGCAAATCATAATTCTAGTCCAGCCAGGAAAGGAAGT
ATCCTGCCTTTTGTACCCGTTTACATGACATTTGAAGATATAAGATACAGTATAGACATG
CCAAAGGCACTGAAAGTACAGGGTATGGCAGGGAGTCGGTTGGAACTACTGAAGGATCTT
AGTGGTTCATTTAGGCCAGGAGTGCTTACAGCACTTATGGGTATCAGTGGTGCAGGCAAG
ACAACATTGTTGGATGTGTTAGCTGGGAGGAAGACCAGTGGACACATACATGGTAATATT
ACTGTATCTGGCTATCCGAAGAAGCAAGAAACATTTTCTCGAGTTTCAGGATATTGTGAA
CAAAATGATATCCATTCACCAAATCTAACTGTCTATGAATCCCTTATGTTCTCAGCATGG
CTTAGATTACCAGCCGAAATTGATTCTATGGCAAGAAAGAGATTTATTGATGAGTTCATG
GAGCTTGTGGAGCTCTTTCCCTTAAAAGATGCATTGGTTGGATTGCTTGGCTTGAGTGGA
TTATCAACTGAACAAAGGAAACGGCTAACAATAGCAGTGGAACTAGTTGCAAACCCATCT
ATCATATTCATGGATGAACCAACATCTGGACTTGATGCACGAGCAGCAGCCATTGTCATG
AGGACAGTAAGGAATATTGTGGACATGGGAAGAACTGTTGTTTGCACAATCCACCAACCT
AGTATTGATATATTTGAATCATTTGATGAGCTCTTCCTAATGAAAAGAGGAGGTGAAGCA
ATTTATGTAGGTCCATTAGGACAACATTCATGTGAATTGATCAAATATTTTGAGTCTATT
GAAGGTGTCAGGAAGATAAAACATGGCTACAATCCTTCAACATGGATGCTGGAAGTGACT
TGTACATTGCAGGAACAGATAACTGGGGTTAACTTTACTCAAGTATACAAGAATTCTGAA
CTATATAGGAGGAACAAAAATTTGATAAAGGAGTTAAGCACACCCCATGACGGTTCAAGC
GACTTATTGTTTCCAACTAAATATTCACAGACCTTTGTTATACAATGTTTGGCTTGCCTC
TGGAAGCAACGTTTGTCATATTGGAGGAATCCTCCATATATTGCTGTGAATTTCTTCTTC
ACCGTTGTAATTGCACTATTGTTTGGAACAATGTTCTGGGGCGTTGGTAGAAAAAGGCAA
AGTCAACAAGCCTTGCTCAGTGCCATGGGTTCCATGTATTCCACATGTTTCACTCTAGGA
GTGCAGAACTCTTCTTCAGTTCAACCAGTTGTCAATATTGAACGCACGGTCTTTTACAGG
GAAAGAGCATCTCACATGTACTCGCCTTTGCCATATGCCTTGGGGCAGGTTGTAGTTGAA
CTTCCTTACATCTTCCTCCAAACCTTGATATATGGTGTGATAGTGTATTCTATGATGGGA
TACGAGTGGACATGCACCAAGTTTTTTTGGTACATGTTCTTCATGTACTTCACTCTATCA
TACTTCACATTTTATGGCATGATGGCGGCAGGTCTAACTCCAAACTACACCATGTCCTCT
ATTGTTTCCACAACTTTCTATGCCATATGGCACCTTTTCTCTGGATTTCTAATACCAAAA
ACAAGAATTCCAATATGGTGGAGATGGTACTATTGGATTTGCCCTGTTGCATGGACAATC
AATGGGTTGGTTACTTCACAGTTTGGGGATGTAGATGACAAGTTTGATAACGGTGTGCGT
GTATCTGACTTTGTTGAGAGCTACTTTGGTTACAATCTTGACTTGTTATGGGTGGCTGCT
ATGGCCGTTGTGTCATTTGCAATTCTTTTTGCCATCCTTTTCGGATTCTCACTTAAGCTA
TTCAACTTCCAAAAGAGATAA

Protein

826 aa

>Os09t0332300-00 Similar to PDR20.
MNILQRLMKTMQSCRCFRQFLVLFVMSEAICGLFRFIAALTRHPVVASTVSEFCILIVMV
SSGFILSRDEVKKWLIWEYWTSPLMYALNALAVNEFLSPSWNEALPGFREPLGRLVLESR
GVFPEAKWYWIGLGALLGYVLLFNILYTICLSILTLLKRNVREMSQETLQIKLENLTGYD
QEPSSGGRVTNDKRYTEGGNNDEATSSNANHNSSPARKGSILPFVPVYMTFEDIRYSIDM
PKALKVQGMAGSRLELLKDLSGSFRPGVLTALMGISGAGKTTLLDVLAGRKTSGHIHGNI
TVSGYPKKQETFSRVSGYCEQNDIHSPNLTVYESLMFSAWLRLPAEIDSMARKRFIDEFM
ELVELFPLKDALVGLLGLSGLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVM
RTVRNIVDMGRTVVCTIHQPSIDIFESFDELFLMKRGGEAIYVGPLGQHSCELIKYFESI
EGVRKIKHGYNPSTWMLEVTCTLQEQITGVNFTQVYKNSELYRRNKNLIKELSTPHDGSS
DLLFPTKYSQTFVIQCLACLWKQRLSYWRNPPYIAVNFFFTVVIALLFGTMFWGVGRKRQ
SQQALLSAMGSMYSTCFTLGVQNSSSVQPVVNIERTVFYRERASHMYSPLPYALGQVVVE
LPYIFLQTLIYGVIVYSMMGYEWTCTKFFWYMFFMYFTLSYFTFYGMMAAGLTPNYTMSS
IVSTTFYAIWHLFSGFLIPKTRIPIWWRWYYWICPVAWTINGLVTSQFGDVDDKFDNGVR
VSDFVESYFGYNLDLLWVAAMAVVSFAILFAILFGFSLKLFNFQKR*

CDS

chr09:9949123..9949327 (- strand) : 205 bp

chr09:9948905..9949008 (- strand) : 104 bp

chr09:9948675..9948831 (- strand) : 157 bp

chr09:9948458..9948574 (- strand) : 117 bp

chr09:9948222..9948364 (- strand) : 143 bp

chr09:9947770..9948102 (- strand) : 333 bp

chr09:9947381..9947671 (- strand) : 291 bp

chr09:9947163..9947246 (- strand) : 84 bp

chr09:9946946..9947079 (- strand) : 134 bp

chr09:9946181..9946408 (- strand) : 228 bp

chr09:9945897..9946068 (- strand) : 172 bp

chr09:9945495..9945749 (- strand) : 255 bp

chr09:9945093..9945350 (- strand) : 258 bp

3'UTR

chr09:9944988..9945092 (- strand) : 105 bp

FASTA

>Os09t0332300-00 class=Sequence position=chr09:9944988..9949327 (- strand)
ATGAATATAT TGCAAAGATT AATGAAAACA ATGCAATCTT GTAGATGTTT TAGACAATTC CTTGTGCTTT TTGTAATGTC
CGAGGCAATA TGTGGACTTT TCCGTTTCAT TGCTGCTCTT ACAAGGCATC CAGTTGTTGC AAGCACCGTG AGTGAATTCT
GTATACTAAT AGTTATGGTT TCAAGCGGAT TCATCCTATC AAGAGGTACA CAAACTATCT GACAAAACAC GACATGATAT
TGGCATTACT TCTGATATTA TTTCCACATG TGTTGGTACT TGTATACATA TTGTATGATA TGTTTGTTTG ATTTAACAGA
TGAAGTTAAA AAATGGCTGA TATGGGAGTA CTGGACATCA CCCCTGATGT ATGCACTAAA TGCCTTAGCA GTAAATGAAT
TCCTAAGTCC CAGCTGGAAT GAGGTAAAAA AAAACTTATG GAATCAATCG AAATCCATAT ATCATAATAT GTCCATTAAA
AACATTTTGT TATCAGGCAC TACCTGGTTT TAGAGAACCA CTTGGAAGGT TAGTTCTGGA ATCTCGTGGG GTTTTCCCGG
AGGCCAAATG GTATTGGATT GGTCTTGGTG CCTTGCTTGG ATATGTGCTT CTGTTCAATA TCCTCTACAC CATCTGCCTC
TCAATTCTCA CATGTGAGTT AGAGAAAAAA ATGAATTTCT TATATTAGTA AAAGCTATTG TTGTTTTAAA AAGGGGCTAT
ACATTCTAAA TTTATGCACC ATGTTCTCTG CAGTACTTAA AAGAAATGTG CGAGAAATGT CTCAGGAAAC ATTGCAGATA
AAACTAGAAA ATTTAACCGG TTATGATCAA GAGCCATCAT CTGGAGGCCG AGTTACCAAT GATAAAAGAT GTAATTTTAT
ATTCACCAAT ATAAAATACT ATATATCACA ATGAGATTTA ATTTAATAAA TTATATAACT TTCTTCTGTG TTATGTCTAC
TAGACACTGA GGGTGGCAAC AATGATGAAG CAACTTCAAG CAATGCAAAT CATAATTCTA GTCCAGCCAG GAAAGGAAGT
ATCCTGCCTT TTGTACCCGT TTACATGACA TTTGAAGATA TAAGATACAG TATAGACATG CCAAAGGTAC ACAAATATTC
CTTTGTCTGG TCTTGACATG CATGTTCTAT CTATAAATCG CCTATAAACA TAACATTTAT GAGCAAACTC CATATATAAT
TGTCTTTATC CAACAAAACA TGTAGGCACT GAAAGTACAG GGTATGGCAG GGAGTCGGTT GGAACTACTG AAGGATCTTA
GTGGTTCATT TAGGCCAGGA GTGCTTACAG CACTTATGGG TATCAGTGGT GCAGGCAAGA CAACATTGTT GGATGTGTTA
GCTGGGAGGA AGACCAGTGG ACACATACAT GGTAATATTA CTGTATCTGG CTATCCGAAG AAGCAAGAAA CATTTTCTCG
AGTTTCAGGA TATTGTGAAC AAAATGATAT CCATTCACCA AATCTAACTG TCTATGAATC CCTTATGTTC TCAGCATGGC
TTAGATTACC AGCCGAAATT GATTCTATGG CAAGAAAGGT TAGACATGAA AGAAACACTT TTTTGAACGT CAAGTAGTAT
ATAAGTACGT ATCATGACAT GACATGCTAG TCTTTTTTCG TGTGCTTGGT TTGTAGAGAT TTATTGATGA GTTCATGGAG
CTTGTGGAGC TCTTTCCCTT AAAAGATGCA TTGGTTGGAT TGCTTGGCTT GAGTGGATTA TCAACTGAAC AAAGGAAACG
GCTAACAATA GCAGTGGAAC TAGTTGCAAA CCCATCTATC ATATTCATGG ATGAACCAAC ATCTGGACTT GATGCACGAG
CAGCAGCCAT TGTCATGAGG ACAGTAAGGA ATATTGTGGA CATGGGAAGA ACTGTTGTTT GCACAATCCA CCAACCTAGT
ATTGATATAT TTGAATCATT TGATGAGGTG AACAAAATTA TAGCAATATA GTGCATTTTC TCACACAGAT TTAATGGGTA
TACAAGAAAA AAGTAAATCA CTGGTGGATT AACATTATTT GCATCCCACT CAATTCCTTC TGGTATTGTT CATATTTACA
GCTCTTCCTA ATGAAAAGAG GAGGTGAAGC AATTTATGTA GGTCCATTAG GACAACATTC ATGTGAATTG ATCAAATATT
TTGAGGTTAG AAAAAAATCG CATAATGTAA TACATGCTTG AATTTTTGCA CTCAGAAACA TGCTATTGAA CTGCTTTCAT
TTTTAAAGTC TATTGAAGGT GTCAGGAAGA TAAAACATGG CTACAATCCT TCAACATGGA TGCTGGAAGT GACTTGTACA
TTGCAGGAAC AGATAACTGG GGTTAACTTT ACTCAAGTAT ACAAGAATTC TGAACTATAT AGGTAGGGAT GGGGTCATCC
TTTAGTTAAT AGTCTGACTA TATACCTTTA ATCGTTGCTC CAGCAACAGA AAACCTAGAT GAAAATCAAA CTTTGTGTGA
TGTGCAAGAT GTCTGGTTCC ATAATGGTAT ATGTGATAAA TGTGTCCATG TTTGTGGTAT GTAGAAAATA CTTTGTTCTA
TCATTAGTTA CTTAAGTATA GGTTGAAAAA AGAGAAGACA ATGGTGTCCT TTTATGCATG TCTAAACAAT TTTCAACAAG
CTGGGGAAAC AACTAAAATT ACAAATATGA TATTCTGAAA AAACAATAAT ATAAGTTTTT TTCAATATTA GTAAAGAAAT
GAAATAACAA TACAAGGTAG TGGCAAAAGC AAAAAATATC CCTACATGAA TCATATATTG TGATGATATC ATAATGCTAA
ACTACAGATG CTTCAAAAGA TCTGCAATTT ACACTTTTAT AATGAATGTT TCAAATATAT GAAAAATTTA ATAGGTAATG
TTATTGTTTG ATGATATTAG TGCTTTGTTT TCCCTACAGG AGGAACAAAA ATTTGATAAA GGAGTTAAGC ACACCCCATG
ACGGTTCAAG CGACTTATTG TTTCCAACTA AATATTCACA GACCTTTGTT ATACAATGTT TGGCTTGCCT CTGGAAGCAA
CGTTTGTCAT ATTGGAGGAA TCCTCCATAT ATTGCTGTGA ATTTCTTCTT CACCGTTGTA ATTGCACTAT TGTTTGGAAC
AATGTTCTGG GGCGTTGGTA GAAAAAGGTA AATATATATA ACAATAAACA CAAGGAAATA TTTTATATTT GTGATTTTCT
TTACAGATTT TAAAGGTTGC CATTGGACCA TGCTTACCCT AAATATTCCT TTCTCATAGG CAAAGTCAAC AAGCCTTGCT
CAGTGCCATG GGTTCCATGT ATTCCACATG TTTCACTCTA GGAGTGCAGA ACTCTTCTTC AGTTCAACCA GTTGTCAATA
TTGAACGCAC GGTCTTTTAC AGGGAAAGAG CATCTCACAT GTACTCGCCT TTGCCATATG CCTTGGGGCA GGTATGGTTC
TTTGGCATCA TAGTGTTTAC ACATGAGGCT AGATATAATG TTTCAAGATT GTGTTCAATT TCTACAAAAC TAAAACCCTT
GGTAAGTGGA CAGAAATGAT AAATGAATAA GCTTTGTTAA CATCTAGTTC TATTGCAGGT TGTAGTTGAA CTTCCTTACA
TCTTCCTCCA AACCTTGATA TATGGTGTGA TAGTGTATTC TATGATGGGA TACGAGTGGA CATGCACCAA GTTTTTTTGG
TACATGTTCT TCATGTACTT CACTCTATCA TACTTCACAT TTTATGGCAT GATGGCGGCA GGTCTAACTC CAAACTACAC
CATGTCCTCT ATTGTTTCCA CAACTTTCTA TGCCATATGG CACCTTTTCT CTGGATTTCT AATACCAAAA ACAGTTAAGT
ATACTAGCTT TTCTCAAATA TCAATGTATA CAAGGTTCCT AGCCAAATTA TCTCAAAGCC AAGACTAGAA AAAAAATTAA
GAAGTACTAC CAAACTTCAC TCCTAGTTTT CCTAAATATG GCTCCTTTTA TCTGCAGAGA ATTCCAATAT GGTGGAGATG
GTACTATTGG ATTTGCCCTG TTGCATGGAC AATCAATGGG TTGGTTACTT CACAGTTTGG GGATGTAGAT GACAAGTTTG
ATAACGGTGT GCGTGTATCT GACTTTGTTG AGAGCTACTT TGGTTACAAT CTTGACTTGT TATGGGTGGC TGCTATGGCC
GTTGTGTCAT TTGCAATTCT TTTTGCCATC CTTTTCGGAT TCTCACTTAA GCTATTCAAC TTCCAAAAGA GATAATTCAT
ATGTACTAGA GTTTCATAAT TTGATTAGCC CGGATAAAAC ACATATTATA ATAGAAGATA TTTTCAATAA TTTTAAAGTA
TTTAAATAAT AGCAGATAGC 

Locus: Os09g0332300

Loading...

Locus: Os09g0332300

Loading...