Os09t0332700-01

Locus

Os09g0332700

Description

Similar to PDR-type ABC transporter 2 (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPDR20, RDR20

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067899 (DDBJ, Best hit)

Protein Evidence

A3BXL8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

Full-length cDNA

J013122C21 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0332700-01)

RiceXPro (AK067899)

Others

Oryzabase (12040)

KEGG (Os09t0332700-01)

Transcript

2142 bp

>Os09t0332700-01 Similar to PDR-type ABC transporter 2 (Fragment).
ATCTTCTTCGACGCGTCGCGCCGGTGAGCACTCACACTCTCACCGGCGGCGGGCGGCGGC
GGGATCGATGGACGACGCCGGCGAGATACACGCGCTCGGGGGCAGCCTGCGGCGGGAGGC
GTCGTCGGCGCGGTCGGGCGACGCCGCCGTGTTCTTCTCGCGGTCGTCGTCGAGGGATGA
GGACGACGAGGAGGCGCTGCGGTGGGCGGCGCTGGAGAAGCTCCCCACCTACGACAGGGC
GCGGACGGCGGTGCTGGCCATGCCGGAGGGCGAGCTCCGGGAGGTGAACGTGCAGCGCCT
CGGCCCCCAGGAGCGGCACGCGCTGCTGCAGCGCCTCGCCTGGGTCGGCGACGACCACGC
CCGCTTCCTCTCCAAGTTCAAGGACCGCGTCGACAGGGTTGGGATCGAGCTGCCGACGAT
CGAGGTGCGGTACGAGAACCTGAATGTGGAAGCGGAGGCGTACGTTGGTAGCAGAGGTTT
GCCCACCATCCTCAACACCTACGCCAATGTGCTGGAGGGTCTGGCAAACACTCTTCACAT
AACACCAAATAGGAAGCAGAAAATATCGATCCTTCACAATGTCAGTGGGATAATCAAGCC
TCACAGAATGACCTTGCTTTTGGGTCCTCCTGGCGCTGGAAAAACCACACTTCTTTTGGC
CTTGGCTGGAAATGTCCCTTCAGGTCTAAAGGTATCTGGACAAATAACATACAATGGCCA
TACCATGGATGAATTCGAGCCCCGGAGATCAGCAGCTTATGTTAGTCAACATGATCTACA
TATGGGTGAATTGACGGTTCGTGAGACAGTCAATTTCTCTGCAAAATGTCAAGGAATTGG
CCACCGTTACGATCTGCTAATGGAACTATCAAGGAGAGAAAAGGAAGAAAATATTAAACC
AGATCCAGAAGTAGATATATACTTGAAGGCTGCTGCAACAGGAGAGCAGAAAGCCGAGGT
GGTCACAAATCACATACTAAAGGTCTTGGGATTGGATATTTGCGCTGACACAATCGTAGG
CAACAATATGTTGAGAGGCATATCAGGGGGGCAGAAAAAGAGAGTAACCACAGCTGAGAT
GATTGTCACCCCAGGACGAGCCCTTTTCATGGATGAGATATCAACTGGACTTGACAGCTC
CACAACATACAATATTGTGGACTCCATCCGGCAGACCATCCACATTGTTGGTGGAACAGC
AGTCATTGCTTTGTTACAACCTGCACCAGAGACATATGAATTGTTTGATGATATAATCCT
CCTCTCAGACGGTCAGGTCGTCTACAATGGTCCTCGTGAACATGTGCTAGAATTCTTTGA
ATCAGTTGGCTTCAAATGTCCTGAGAGAAAAGGCTGCAGAATTCTTCTTCCGTTCAGCCA
GTTGTGTCTGTTGAACGCACTGTGTTCTACAGGGAACGAGCAGCTCACATGTATTCACCT
TTGCCATACGCCTTGGGACAGGTTGCAATTGAACTTCCATACATCCTTGTTCAGTCCTTA
ATATATGGTGTTCTAGTGTATGCAATGATTGGATTTGAGTGGACAGCTGCCAAGTTCTTT
TGGTACCTGTTTTTCATGTATTTCACTTTATCATACTACACATTTTATGGCATGATGTCG
GTGGGTCTGACTCCAAGCTATAACGTGGCCTCTGTTGTTTCCACTGCATTCTATGCCATA
TGGAACCTTTTCTCAGGATTTATAATACCAAGAACTCGAATTCCAATATGGTGGAGATGG
TACTATTGGGTCTGCCCTGTTGCGTGGACACTCTACGGGTTGGTAACTTCACAGTTCGGG
GATGTAACTGACACGTTTGATAATGGTGTCCGTATATCTGACTTTGTCGAGAGCTACTTT
GGTTACCATCGTGACTTCTTGTGGGTGGTTGCCGTGATGGTGGTCTCATTTGCCGTCCTC
TTCGCCTTCCTTTTCGGGCTCTCAATCAAGATATTCAACTTCCAGAAGAGATAAATTGAG
GAAGGCATACCCGAGTTGTGTATAGCATGTGAATACTAGCACATCGTAATTGTACAGCTT
GAAAGCACATTTGTATCACCATAATTGTACATCTTAAAGCACATTGTGTATCCTGGAATT
CATGGTACTCAGATTAACAAGTTGTTTCATTGAGTTTTTTGC

CDS

1434 bp

>Os09t0332700-01 Similar to PDR-type ABC transporter 2 (Fragment).
ATGGACGACGCCGGCGAGATACACGCGCTCGGGGGCAGCCTGCGGCGGGAGGCGTCGTCG
GCGCGGTCGGGCGACGCCGCCGTGTTCTTCTCGCGGTCGTCGTCGAGGGATGAGGACGAC
GAGGAGGCGCTGCGGTGGGCGGCGCTGGAGAAGCTCCCCACCTACGACAGGGCGCGGACG
GCGGTGCTGGCCATGCCGGAGGGCGAGCTCCGGGAGGTGAACGTGCAGCGCCTCGGCCCC
CAGGAGCGGCACGCGCTGCTGCAGCGCCTCGCCTGGGTCGGCGACGACCACGCCCGCTTC
CTCTCCAAGTTCAAGGACCGCGTCGACAGGGTTGGGATCGAGCTGCCGACGATCGAGGTG
CGGTACGAGAACCTGAATGTGGAAGCGGAGGCGTACGTTGGTAGCAGAGGTTTGCCCACC
ATCCTCAACACCTACGCCAATGTGCTGGAGGGTCTGGCAAACACTCTTCACATAACACCA
AATAGGAAGCAGAAAATATCGATCCTTCACAATGTCAGTGGGATAATCAAGCCTCACAGA
ATGACCTTGCTTTTGGGTCCTCCTGGCGCTGGAAAAACCACACTTCTTTTGGCCTTGGCT
GGAAATGTCCCTTCAGGTCTAAAGGTATCTGGACAAATAACATACAATGGCCATACCATG
GATGAATTCGAGCCCCGGAGATCAGCAGCTTATGTTAGTCAACATGATCTACATATGGGT
GAATTGACGGTTCGTGAGACAGTCAATTTCTCTGCAAAATGTCAAGGAATTGGCCACCGT
TACGATCTGCTAATGGAACTATCAAGGAGAGAAAAGGAAGAAAATATTAAACCAGATCCA
GAAGTAGATATATACTTGAAGGCTGCTGCAACAGGAGAGCAGAAAGCCGAGGTGGTCACA
AATCACATACTAAAGGTCTTGGGATTGGATATTTGCGCTGACACAATCGTAGGCAACAAT
ATGTTGAGAGGCATATCAGGGGGGCAGAAAAAGAGAGTAACCACAGCTGAGATGATTGTC
ACCCCAGGACGAGCCCTTTTCATGGATGAGATATCAACTGGACTTGACAGCTCCACAACA
TACAATATTGTGGACTCCATCCGGCAGACCATCCACATTGTTGGTGGAACAGCAGTCATT
GCTTTGTTACAACCTGCACCAGAGACATATGAATTGTTTGATGATATAATCCTCCTCTCA
GACGGTCAGGTCGTCTACAATGGTCCTCGTGAACATGTGCTAGAATTCTTTGAATCAGTT
GGCTTCAAATGTCCTGAGAGAAAAGGCTGCAGAATTCTTCTTCCGTTCAGCCAGTTGTGT
CTGTTGAACGCACTGTGTTCTACAGGGAACGAGCAGCTCACATGTATTCACCTTTGCCAT
ACGCCTTGGGACAGGTTGCAATTGAACTTCCATACATCCTTGTTCAGTCCTTAA

Protein

477 aa

>Os09t0332700-01 Similar to PDR-type ABC transporter 2 (Fragment).
MDDAGEIHALGGSLRREASSARSGDAAVFFSRSSSRDEDDEEALRWAALEKLPTYDRART
AVLAMPEGELREVNVQRLGPQERHALLQRLAWVGDDHARFLSKFKDRVDRVGIELPTIEV
RYENLNVEAEAYVGSRGLPTILNTYANVLEGLANTLHITPNRKQKISILHNVSGIIKPHR
MTLLLGPPGAGKTTLLLALAGNVPSGLKVSGQITYNGHTMDEFEPRRSAAYVSQHDLHMG
ELTVRETVNFSAKCQGIGHRYDLLMELSRREKEENIKPDPEVDIYLKAAATGEQKAEVVT
NHILKVLGLDICADTIVGNNMLRGISGGQKKRVTTAEMIVTPGRALFMDEISTGLDSSTT
YNIVDSIRQTIHIVGGTAVIALLQPAPETYELFDDIILLSDGQVVYNGPREHVLEFFESV
GFKCPERKGCRILLPFSQLCLLNALCSTGNEQLTCIHLCHTPWDRLQLNFHTSLFSP*

5'UTR

chr09:9979284..9979350 (- strand) : 67 bp

CDS

chr09:9978955..9979283 (- strand) : 329 bp

chr09:9978642..9978762 (- strand) : 121 bp

chr09:9977486..9977574 (- strand) : 89 bp

chr09:9977324..9977408 (- strand) : 85 bp

chr09:9977064..9977223 (- strand) : 160 bp

chr09:9976903..9976979 (- strand) : 77 bp

chr09:9976715..9976768 (- strand) : 54 bp

chr09:9976454..9976544 (- strand) : 91 bp

chr09:9976077..9976357 (- strand) : 281 bp

chr09:9971620..9971726 (- strand) : 107 bp

chr09:9971306..9971345 (- strand) : 40 bp

3'UTR

chr09:9971091..9971305 (- strand) : 215 bp

chr09:9970574..9970999 (- strand) : 426 bp

FASTA

>Os09t0332700-01 class=Sequence position=chr09:9970574..9979350 (- strand)
ATCTTCTTCG ACGCGTCGCG CCGGTGAGCA CTCACACTCT CACCGGCGGC GGGCGGCGGC GGGATCGATG GACGACGCCG
GCGAGATACA CGCGCTCGGG GGCAGCCTGC GGCGGGAGGC GTCGTCGGCG CGGTCGGGCG ACGCCGCCGT GTTCTTCTCG
CGGTCGTCGT CGAGGGATGA GGACGACGAG GAGGCGCTGC GGTGGGCGGC GCTGGAGAAG CTCCCCACCT ACGACAGGGC
GCGGACGGCG GTGCTGGCCA TGCCGGAGGG CGAGCTCCGG GAGGTGAACG TGCAGCGCCT CGGCCCCCAG GAGCGGCACG
CGCTGCTGCA GCGCCTCGCC TGGGTCGGCG ACGACCACGC CCGCTTCCTC TCCAAGTTCA AGGACCGCGT CGACAGGTAC
CAGATTCGAA TTTTTCTTTT CTTCTTTTTC AAATTCCGCC CTCCTCAGTT CAGTTTAGAG TTCAGACGAA GAAAAAACTA
TTTCCAAAAA TTCGAAAAAG TTCTCTCGCG TGATTCCAAA TTAGTGTCAC ATCATGATAA GTGTAGAGTG ATTTTGATGG
TTTTGGATTG ATGGATGCGC GCATGCAGGG TTGGGATCGA GCTGCCGACG ATCGAGGTGC GGTACGAGAA CCTGAATGTG
GAAGCGGAGG CGTACGTTGG TAGCAGAGGT TTGCCCACCA TCCTCAACAC CTACGCCAAT GTGCTGGAGG TACTATATCA
TCAGTCTATA ATAATAATCA TCATGTGTTG TGGTAACTAA TCACAAACAA TTGAGTAGTT TCGCCAACTA ATCTGGCTGA
TGATGAGAGT TGGTACAGAG ATTGTTCAGT TTTTCAGATT AGTTTTGGGG TTTTAGAGTA CTCACAGTTC AGCAGTAGGC
AGTTTTCTGA ATAAACTGAA CACTTTGCCC GCTTTTCATT GGTGTACAGG GTACCTACCC TGATGTGTTT ACGTGCTTGA
GCTTTGCATA GTAATGCCAA AGTGTCACAG TCAATACTCA ATAAAATATG CTACGAGACG TCAAAATAAA TTGGTCTCGT
TGACTATTTT CAGAGAGGGT ACTTCTAGTC AGAGTTTTCT TTCTATTGCA ATAATAGAAA CGTAACTCAA ACTGGTACAT
CCACCGATAG GAGAAAATTa gtaaatttca caaaactaca aatactttgt tcaaattatc acaaaactac agatttaagg
tgatatatca taaaactaca gaattaaAGT GATGTATCAA TCTGTAGTTT TGTGTTAATT TAGTCAATAT ATCTGTGGTT
TTGTGAAACT TAGTTGGCAA AAACAAATTC AGTGCTTGTC ATTAATTTTG ATTACGACAA TCGCCCGTGT TAGCTAGAGA
GCTTCCTGTA GTGCAGCAAA ATTCTGGGCC ACTGTTAAGA CAGTCAAACC GGTGATCCTG AAGAGCAACG AGATTAGGTT
CTCTGGTTGG AGTTGGTAAC ACGACTTCTC TTGGACATCT TGATAAACAG CAGACTTGCC TGATTGGTAC TCCAAACATA
GGGCTCTGCA AATACAGAAT TCATCATCAG TAGACCTCCT AAACAATATC TACAGCAAGG ATGTAAATAA CACATAAACA
AGGATATCAA GTTAAATTAA ATTTATTTTT AGTTTAACAG AAGGAACTGT GAATGTAAAA CATGAATGTA CAGTACACTT
TTTGTTTGCA TTCATCTACC AAATGACATC AGACTCCCTT CTTGTACTGT CCACGCATGT GCACTGACAA GGTGTTAATC
ACCTCCATAC AAACAGGGTC TGGCAAACAC TCTTCACATA ACACCAAATA GGAAGCAGAA AATATCGATC CTTCACAATG
TCAGTGGGAT AATCAAGCCT CACAGGTAAC TTCCCAGCAT ATTGCCAGTT TCCAGATAAT ATTCATTTTG TTCAGTATGT
TAACTTATAC CTCTGTTTTC AGAATGACCT TGCTTTTGGG TCCTCCTGGC GCTGGAAAAA CCACACTTCT TTTGGCCTTG
GCTGGAAATG TCCCTTCAGG TCTAAAGGTA CTCAATTATT CTTTTTATTT ACTTGAGTAC ATTGCTTTGT CAGTTTATCA
TACCCTTGGA AGTACTAGTA CTAAATGTAA CATTGCAACC GCACAAGGTA TCTGGACAAA TAACATACAA TGGCCATACC
ATGGATGAAT TCGAGCCCCG GAGATCAGCA GCTTATGTTA GTCAACATGA TCTACATATG GGTGAATTGA CGGTTCGTGA
GACAGTCAAT TTCTCTGCAA AATGTCAAGG AATTGGCCAC CGTTACGGTA AGAAACAGAA AAATGAAAAA AAAAATCTGG
ACAATGGCAT GTCACATGGA ATAGCTAACA ATTTTCTGAA AAAATGCTCA GATCTGCTAA TGGAACTATC AAGGAGAGAA
AAGGAAGAAA ATATTAAACC AGATCCAGAA GTAGATATAT ACTTGAAGGT TCAATGCAGT TCTTATATCA CAATTCATTT
AATTCACAAG TTGTTCCATT TTGTTGATTT TTAGTTTTTG TCATCTACAA TTGTTTCAGA GAATAGCTTC ATTCATATGA
ACTTCCTATT TGGCTTGTGT AGGCTGCTGC AACAGGAGAG CAGAAAGCCG AGGTGGTCAC AAATCACATA CTAAAGGTGC
ATGAACAATA ACTACTTATA TACAGTTCTA ATATAATTTA CGTTAGCTAT CACCATTCAA ACTTCAATGG CAACAAATGT
TTCTCCCATG TTCTCAGGGG GTATACAAAA TGAAAGGTGT TTATGATACT AATTCTTCAA TTCTTGTTTT TATTCAACTA
TTGAAGGTCT TGGGATTGGA TATTTGCGCT GACACAATCG TAGGCAACAA TATGTTGAGA GGCATATCAG GGGGGCAGAA
AAAGAGAGTA ACCACAGGTA ATGTATCTTT GGTACAAATA AAGTACTAGA TGCTTACATA TTGCAGACAT ACAAGGTTCA
CTGCTTACCC GGACCCTGAA ATTGGTGTTG CAGCTGAGAT GATTGTCACC CCAGGACGAG CCCTTTTCAT GGATGAGATA
TCAACTGGAC TTGACAGCTC CACAACATAC AATATTGTGG ACTCCATCCG GCAGACCATC CACATTGTTG GTGGAACAGC
AGTCATTGCT TTGTTACAAC CTGCACCAGA GACATATGAA TTGTTTGATG ATATAATCCT CCTCTCAGAC GGTCAGGTCG
TCTACAATGG TCCTCGTGAA CATGTGCTAG AATTCTTTGA ATCAGTTGGC TTCAAATGTC CTGAGAGAAA AGGCGTAGCA
GACTTCTTGC AGGAAGTGAG TAATTGAGTT CTCTCAACAT GTTTTATCAA GCTTTTTTCT AGTGACACAT CTCATGGAAA
AAATGCAGTA TCTTGTTACA GAACAAGACT GGACATATAT GACAAAGTAA ACTATGCAAA TATAATATTG TTTACAAATG
AAATGGATAT AGAAGTAGCA TTACTTGAAA ATATTTCTTA TACTGGACTT GAAAATATTT CTTACACTGG GCTTTCTCGC
TTAAGAAAAA ATAGAAATTA AAAGAAGAGG ACAATGTAGA AAACTTTCTA GAGAATTTTT AAATGCTACA ATCATAATTT
AGTGCAACTT TTGAGTTTGA ATTAATATAA ATGATATGTT ATAGGTTACT TCAAGGAAAG ATCAGCGGCA ATACTGGATG
CATGGTGATG AGACATACCG ATATGTTCCT GTTAAGGAGT TTGCAGAGGC ATTTCAGTCT TTCCATGTTG GTCAGGCAAT
AAGAAGTGAG TTGGCAATCC CATTTGACAA GAGCAGGAGC CACCCTGCTG CCCTGAAAAC ATCAAAATAT GGTGCTAGCA
TGAAAGAACT GCTTAAAGCG AACATTGACA GAGAGATATT GCTCATGAAA AGGAACTCCT TTGTGTATAT ATTCAAGGCA
ACTCAGGTTA TTCTTGAAAC CGAAACTTTT CAATACAGGT TTCTATTAAG AAAAAACATG GAAGCCGATA ACAAATTTAA
TTTGTGTTGT TTCTCTCTTA TTCAGTTAAC ACTCATGACA TTCATTGCGA TGACTGTCTT TATCCGCACC AATATGCATC
ATGACTCAAT AACAAATGGG GGAATATACA TGGGCGCACT CTTCTTTGGG ATCCTGATGA TCATGTTCAA CGGATTGGCA
GAAGTTGGTC TAACTATTGC AAAACTCCCT GTTTTCTTCA AGCAAAGGGA TCTCCTCTTC TATCCAGCAT GGACATACTC
CTTACCATCA TGGATCATTA AGACTCCACT CTCCTTGCTC AATGTAACAA TATGGGTCTT CATAACATAT TATGTCATTG
GATTTGATCC CAATGTAGAG AGGTAAAGAA AACAAAATTT CCACATTGCA TTGTGCCTTC CTATGAATGT ATTGCAGAAA
CTAATGAAAT AATTCAATGC TTCAGGCTTT TTAGACAGTT CCTGCTGCTT TTAGTAATGA ATGAGACATC ATCTGGACTG
TTTCGCTTCA TTGCTGGGTT TGCAAGGCAT CAGGTTGTTG CAAGCACTAT GGGTTCATTC TGTATACTCA TTTTTATGCT
TTTGGGAGGA TTTATCCTGT CAAGAGGTAA GGCAGAAATT ATCTATATTC TTCAATCAGA TTGCTTATGT TCCTCTATAA
TTTCCACATC AAAAAAATAA TGAATGGACG CTGATTTGAT TGAACAGAGA ACGTGAAGAA ATGGTGGATA TGGGGATACT
GGATATCACC CCTGATGTAT GCACAAAATG CCATATCAGT AAACGAATTT CTAGGTCACA GCTGGAACAA GGTAAAAAAA
ATACTCATGG AAATCGATTA ACAGCCATTA TATGAATGTC TGGCTAAAGT GTTCTGTTCT TGCTGTACTG CAGACAATAC
CTGGTTTCAG GGAGCCACTT GGAAAACTAG TTCTTGAATC CCGTGGAGTT TTCCCTGAGG CCAAATGGTA TTGGATTGGT
GTTGGTGCAT TGCTCGGATA CGTCCTGCTA TTCAATATCC TCTACACAAT CTGCCTCACA TTCCTCAATC GTGAGTCAGA
AATAAATTAT ATTTGGAATG CCAGAGCTTA TAAATTCTCA TTTTTATAAT TTCTCATTTT TATGCATTCT TTCACTGCAG
CATTTGACAG CAATCAGCCA ACAATATCTG AGGAGACGTT GAAGATAAAA CAAGCTAATC TGACCGGTGA TGTTATAGAA
GCATCCTCGA GAGGACGAAT TACCACCAAC ACAAGTACTG TTCGCTTTTG TATTTAGCTG TCTAAATATG ATTTAACATA
ATGAGTTTCC ATCTAACAAC AACCTCGGAT ATGTGATATG CCTACCAGAC ACTGCGGATG ATAGTAATGA TGAAGCAATT
TCCAACCATG CAACAGTGAA TTCTAGTCCA GGCAAGAAAG GAATGGTTCT CCCTTTTGTA CCTCTCTCCA TCACGTTTGA
AGATATAAGA TACAGTGTTG ACATGCCAGA GGTATTTGGT AGAGAATTAC TGAAATATAA ATATATCTGA AATGTGCATG
CTCAGTATGA AGATTCTCCT ATATCTATAA TACTTAAGAG CAACTCTAAC TGGCTTTAAT ATCCAATGAA ACTTGTAGGT
AATTAAAGCA CAAGGTGTGA CAGAGAGCCG GTTGGAGCTA TTGAAGGGCA TCAGTGGTTC ATTTAGGCCA GGAGTACTTA
CAGCTCTTAT GGGTGTCAGT GGTGCTGGAA AAACAACATT GATGGATGTG TTGGCTGGGA GGAAGACCAG TGGATACATA
GAGGGTAACA TTACCATCTC TGGCTATCCA AAGAAGCAAG AAACTTTTGC TCGTGTATCA GGATACTGTG AGCAGAATGA
CATCCATTCA CCAAATGTTA CTGTCTACGA GTCTCTTGCA TTCTCTGCAT GGCTCCGATT GCCTGCGGAA ATTGATTCTG
CAACAAGAAA GGTTTGACAA AAAATAACTA GTATTTTAAT ATGTAAGCAT ATACCATAAA AGCATACACA GCATGATTAA
AAATGAGAAT GCATTTCTTT TCAATTGATC TAGAATGCCA TGCAATGTAT CAATCAACAA ATAGATGGTG CTAAAAATTT
TAGCTGCAAA GTTTCATACA TAAACTAGAG GGGATGTTCT GGTCATATTT GCATAGTAGA CATTTATTTC GTAACTCGTA
AGACCATCAT GCATATTATG ACAAATGAAA TCTGGTTTGC AGATGTTTAT TGATGAGGTC ATGGAACTTG TGGAGCTTTC
CCCCTTAAAA GACTCCTTGG TTGGATTGCC TGGCGTTAGT GGATTATCAA CAGAACAAAG GAAAAGGCTA ACAATAGCAG
TGGAGCTAGT TGCTAACCCA TCTATCATAT TCATGGATGA ACCAACATCT GGACTTGATG CACGAGCAGC AGCCATTGTC
ATGAGGGCAA TAAGAAATAC TGTGGACACA GGAAGAACAG TTGTTTGCAC AATTCACCAA CCAAGCATTG ACATATTTGA
ATCTTTTGAT GAGGTGATAG AAATCATACC CACTTCTTTT GTCACATGGA TTTAAGATGC ACTCTTTCAA TACATACTTA
TACTATCTTT GCAGCTATTC CTGATGAAAC GAGGAGGTGA GGAGATTTAT GTAGGTCCAG TAGGTCAGCA CTCGTGTGAA
TTGATCAGAT ATTTTGAGGT AAAAAAATTA TATATGTTAC CATCAATTTG ACTTTTTGCT CTAAAAACAT GTAATTGAGC
TGCTTTCATT TTCTAAAGTC TATTGAAGGT GTCAGCAAAA TAAAACATGG CTACAATCCA TCAACATGGA TGCTGGAAGT
GACTAGTACT GTACAGGAAC AGATAACTGG GGTTAACTTC AGTGAAATAT ACAAGAATTC TGAACTGTAC AGGTAAGTAC
CTGGTTGCCA TATGGTTGAT AATTTTGACT ATAGACCATG CAAATTTTAA GCTCCGCAAT TTTATATTGG AAAATTAAGG
CAGCAACGAT CAGTATCATG TTCAGTGTGT CTTAACTATT TTCAAGAGGG TAAGTCACTA AATGGAAAAG ATGAGCCTGT
TTGTGAAAAA AATATGGACT ATAAATGAAG CTCAAATCAT GAATGGCCCA TCACAAATGC TTCAAACTGC CACTATATGT
GTAACATGAT TATTACTGTA GCAATTTATG TTCAAAAGCA TCTAAACGAG TCAATGTTAA CAGTTCAATA ATATTATAGT
CTCTTTTGCA TTACAGGAGG AATAAAAGTA TGATAAAGGA GCTAAGCTCA CCTCCTGATG GTTCAAGTGA CCTATCCTTT
CCAACAGAAT ACTCTCAAAC TTTCATCACA CAATGTTTGG CTTGCCTATG GAAGCAAAGT CTGTCCTACT GGAGAAACCC
TCCATATACT GCTGTCAAAT ACTTCTACAC CATTGTAATT GCACTGTTGT TTGGAACAAT GTTCTGGGGT GTTGGCAGAA
AAAGGTATAC GGTCAATAAA AACAAGTAAA AATGTATATG CAACATTTTC CACTGATTTA GAGAGGCTAC CTTGAGATTA
TATCTGTCAC AATTCACTGA GGATACTCCA CTCTTGCAGG AGCAATCAAC AGGACTTGTT CAATGCCATG GGCTCCATGT
ATGCGTCAGT TTTATTTATG GGAGTGCAGA ATTCTTCTTC CGTTCAGCCA GTTGTGTCTG TTGAACGCAC TGTGTTCTAC
AGGGAACGAG CAGCTCACAT GTATTCACCT TTGCCATACG CCTTGGGACA GGTAAAGTTA TTTTACATTA ACTTTATTAT
ACAATAGCAT TGATATTTGT ATGATAGGAA AGAGAAGATT ATTATTTGAA GGGGAAAAAA GAGCAGCTCA ATTAACATGT
AAAGCATCAA AATCAAATGG AAGCTTGTAC ATATGAGGCT TCTAAAAGGG TTATATAAAA TATTTTAACC AGGATATAAC
ACAATGGTTG AACAACTCCC GAAGTAATTG GAAGAAAATG GTAAAAGAAA CACTATGTGC TGCTAACATA CAATTCTGTC
CGCAGGTTGC AATTGAACTT CCATACATCC TTGTTCAGTC CTTAATATAT GGTGTTCTAG TGTATGCAAT GATTGGATTT
GAGTGGACAG CTGCCAAGTT CTTTTGGTAC CTGTTTTTCA TGTATTTCAC TTTATCATAC TACACATTTT ATGGCATGAT
GTCGGTGGGT CTGACTCCAA GCTATAACGT GGCCTCTGTT GTTTCCACTG CATTCTATGC CATATGGAAC CTTTTCTCAG
GATTTATAAT ACCAAGAACT GTAAGTATAC TAATATTTCA CAAATGTCTT ATAGTAATTT CACTTATGGA GCATCTGCCT
TTTCTAATAC AGCCTATTTT TTTATTGGCA GCGAATTCCA ATATGGTGGA GATGGTACTA TTGGGTCTGC CCTGTTGCGT
GGACACTCTA CGGGTTGGTA ACTTCACAGT TCGGGGATGT AACTGACACG TTTGATAATG GTGTCCGTAT ATCTGACTTT
GTCGAGAGCT ACTTTGGTTA CCATCGTGAC TTCTTGTGGG TGGTTGCCGT GATGGTGGTC TCATTTGCCG TCCTCTTCGC
CTTCCTTTTC GGGCTCTCAA TCAAGATATT CAACTTCCAG AAGAGATAAA TTGAGGAAGG CATACCCGAG TTGTGTATAG
CATGTGAATA CTAGCACATC GTAATTGTAC AGCTTGAAAG CACATTTGTA TCACCATAAT TGTACATCTT AAAGCACATT
GTGTATCCTG GAATTCATGG TACTCAGATT AACAAGTTGT TTCATTGAGT TTTTTGC

Locus: Os09g0332700

Loading...

Locus: Os09g0332700

Loading...