Os09t0332700-02

Locus

Os09g0332700

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPDR20, RDR20

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK060237 (DDBJ, Best hit)

Protein Evidence

B8BEI2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

ABC-2 type transporter (IPR013525)

Full-length cDNA

001-003-C10 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0332700-02)

RiceXPro (AK060237)

Others

Oryzabase (12040)

KEGG (Os09t0332700-02)

Transcript

1512 bp

>Os09t0332700-02 Hypothetical conserved gene.
GGATTATCAACAGAACAAAGGAAAAGGCTAACAATAGCAGTGGAGCTAGTTGCTAACCCA
TCTATCATATTCATGGATGAACCAACATCTGGACTTGATGCACGAGCAGCAGCCATTGTC
ATGAGGGCAATAAGAAATACTGTGGACACAGGAAGAACAGTTGTTTGCACAATTCACCAA
CCAAGCATTGACATATTTGAATCTTTTGATGAGCTATTCCTGATGAAACGAGGAGGTGAG
GAGATTTATGTAGGTCCAGTAGGTCAGCACTCGTGTGAATTGATCAGATATTTTGAGTCT
ATTGAAGGTGTCAGCAAAATAAAACATGGCTACAATCCATCAACATGGATGCTGGAAGTG
ACTAGTACTGTACAGGAACAGATAACTGGGGTTAACTTCAGTGAAATATACAAGAATTCT
GAACTGTACAGGAGGAATAAAAGTATGATAAAGGAGCTAAGCTCACCTCCTGATGGTTCA
AGTGACCTATCCTTTCCAACAGAATACTCTCAAACTTTCATCACACAATGTTTGGCTTGC
CTATGGAAGCAAAGTCTGTCCTACTGGAGAAACCCTCCATATACTGCTGTCAAATACTTC
TACACCATTGTAATTGCACTGTTGTTTGGAACAATGTTCTGGGGTGTTGGCAGAAAAAGG
AGCAATCAACAGGACTTGTTCAATGCCATGGGCTCCATGTATGCGTCAGTTTTATTTATG
GGAGTGCAGAATTCTTCTTCCGTTCAGCCAGTTGTGTCTGTTGAACGCACTGTGTTCTAC
AGGGAACGAGCAGCTCACATGTATTCACCTTTGCCATACGCCTTGGGACAGGTTGCAATT
GAACTTCCATACATCCTTGTTCAGTCCTTAATATATGGTGTTCTAGTGTATGCAATGATT
GGATTTGAGTGGACAGCTGCCAAGTTCTTTTGGTACCTGTTTTTCATGTATTTCACTTTA
TCATACTACACATTTTATGGCATGATGTCGGTGGGTCTGACTCCAAGCTATAACGTGGCC
TCTGTTGTTTCCACTGCATTCTATGCCATATGGAACCTTTTCTCAGGATTTATAATACCA
AGAACTCGAATTCCAATATGGTGGAGATGGTACTATTGGGTCTGCCCTGTTGCGTGGACA
CTCTACGGGTTGGTAACTTCACAGTTCGGGGATGTAACTGACACGTTTGATAATGGTGTC
CGTATATCTGACTTTGTCGAGAGCTACTTTGGTTACCATCGTGACTTCTTGTGGGTGGTT
GCCGTGATGGTGGTCTCATTTGCCGTCCTCTTCGCCTTCCTTTTCGGGCTCTCAATCAAG
ATATTCAACTTCCAGAAGAGATAAATTGAGGAAGGCATACCCGAGTTGTGTATAGCATGT
GAATACTAGCACATCGTAATTGTACAGCTTGAAAGCACATTTGTATCACCATAATTGTAC
ATCTTAAAGCACATTGTGTATCCTGGAATTCATGGTACTCAGATTAACAAGTTGTTTCAT
TGAGTTTTTTGC

CDS

1344 bp

>Os09t0332700-02 Hypothetical conserved gene.
GGATTATCAACAGAACAAAGGAAAAGGCTAACAATAGCAGTGGAGCTAGTTGCTAACCCA
TCTATCATATTCATGGATGAACCAACATCTGGACTTGATGCACGAGCAGCAGCCATTGTC
ATGAGGGCAATAAGAAATACTGTGGACACAGGAAGAACAGTTGTTTGCACAATTCACCAA
CCAAGCATTGACATATTTGAATCTTTTGATGAGCTATTCCTGATGAAACGAGGAGGTGAG
GAGATTTATGTAGGTCCAGTAGGTCAGCACTCGTGTGAATTGATCAGATATTTTGAGTCT
ATTGAAGGTGTCAGCAAAATAAAACATGGCTACAATCCATCAACATGGATGCTGGAAGTG
ACTAGTACTGTACAGGAACAGATAACTGGGGTTAACTTCAGTGAAATATACAAGAATTCT
GAACTGTACAGGAGGAATAAAAGTATGATAAAGGAGCTAAGCTCACCTCCTGATGGTTCA
AGTGACCTATCCTTTCCAACAGAATACTCTCAAACTTTCATCACACAATGTTTGGCTTGC
CTATGGAAGCAAAGTCTGTCCTACTGGAGAAACCCTCCATATACTGCTGTCAAATACTTC
TACACCATTGTAATTGCACTGTTGTTTGGAACAATGTTCTGGGGTGTTGGCAGAAAAAGG
AGCAATCAACAGGACTTGTTCAATGCCATGGGCTCCATGTATGCGTCAGTTTTATTTATG
GGAGTGCAGAATTCTTCTTCCGTTCAGCCAGTTGTGTCTGTTGAACGCACTGTGTTCTAC
AGGGAACGAGCAGCTCACATGTATTCACCTTTGCCATACGCCTTGGGACAGGTTGCAATT
GAACTTCCATACATCCTTGTTCAGTCCTTAATATATGGTGTTCTAGTGTATGCAATGATT
GGATTTGAGTGGACAGCTGCCAAGTTCTTTTGGTACCTGTTTTTCATGTATTTCACTTTA
TCATACTACACATTTTATGGCATGATGTCGGTGGGTCTGACTCCAAGCTATAACGTGGCC
TCTGTTGTTTCCACTGCATTCTATGCCATATGGAACCTTTTCTCAGGATTTATAATACCA
AGAACTCGAATTCCAATATGGTGGAGATGGTACTATTGGGTCTGCCCTGTTGCGTGGACA
CTCTACGGGTTGGTAACTTCACAGTTCGGGGATGTAACTGACACGTTTGATAATGGTGTC
CGTATATCTGACTTTGTCGAGAGCTACTTTGGTTACCATCGTGACTTCTTGTGGGTGGTT
GCCGTGATGGTGGTCTCATTTGCCGTCCTCTTCGCCTTCCTTTTCGGGCTCTCAATCAAG
ATATTCAACTTCCAGAAGAGATAA

Protein

447 aa

>Os09t0332700-02 Hypothetical conserved gene.
GLSTEQRKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAIRNTVDTGRTVVCTIHQ
PSIDIFESFDELFLMKRGGEEIYVGPVGQHSCELIRYFESIEGVSKIKHGYNPSTWMLEV
TSTVQEQITGVNFSEIYKNSELYRRNKSMIKELSSPPDGSSDLSFPTEYSQTFITQCLAC
LWKQSLSYWRNPPYTAVKYFYTIVIALLFGTMFWGVGRKRSNQQDLFNAMGSMYASVLFM
GVQNSSSVQPVVSVERTVFYRERAAHMYSPLPYALGQVAIELPYILVQSLIYGVLVYAMI
GFEWTAAKFFWYLFFMYFTLSYYTFYGMMSVGLTPSYNVASVVSTAFYAIWNLFSGFIIP
RTRIPIWWRWYYWVCPVAWTLYGLVTSQFGDVTDTFDNGVRISDFVESYFGYHRDFLWVV
AVMVVSFAVLFAFLFGLSIKIFNFQKR*

CDS

chr09:9972858..9973070 (- strand) : 213 bp

chr09:9972693..9972776 (- strand) : 84 bp

chr09:9972479..9972612 (- strand) : 134 bp

chr09:9971907..9972134 (- strand) : 228 bp

chr09:9971620..9971791 (- strand) : 172 bp

chr09:9971091..9971345 (- strand) : 255 bp

chr09:9970742..9970999 (- strand) : 258 bp

3'UTR

chr09:9970574..9970741 (- strand) : 168 bp

FASTA

>Os09t0332700-02 class=Sequence position=chr09:9970574..9973070 (- strand)
GGATTATCAA CAGAACAAAG GAAAAGGCTA ACAATAGCAG TGGAGCTAGT TGCTAACCCA TCTATCATAT TCATGGATGA
ACCAACATCT GGACTTGATG CACGAGCAGC AGCCATTGTC ATGAGGGCAA TAAGAAATAC TGTGGACACA GGAAGAACAG
TTGTTTGCAC AATTCACCAA CCAAGCATTG ACATATTTGA ATCTTTTGAT GAGGTGATAG AAATCATACC CACTTCTTTT
GTCACATGGA TTTAAGATGC ACTCTTTCAA TACATACTTA TACTATCTTT GCAGCTATTC CTGATGAAAC GAGGAGGTGA
GGAGATTTAT GTAGGTCCAG TAGGTCAGCA CTCGTGTGAA TTGATCAGAT ATTTTGAGGT AAAAAAATTA TATATGTTAC
CATCAATTTG ACTTTTTGCT CTAAAAACAT GTAATTGAGC TGCTTTCATT TTCTAAAGTC TATTGAAGGT GTCAGCAAAA
TAAAACATGG CTACAATCCA TCAACATGGA TGCTGGAAGT GACTAGTACT GTACAGGAAC AGATAACTGG GGTTAACTTC
AGTGAAATAT ACAAGAATTC TGAACTGTAC AGGTAAGTAC CTGGTTGCCA TATGGTTGAT AATTTTGACT ATAGACCATG
CAAATTTTAA GCTCCGCAAT TTTATATTGG AAAATTAAGG CAGCAACGAT CAGTATCATG TTCAGTGTGT CTTAACTATT
TTCAAGAGGG TAAGTCACTA AATGGAAAAG ATGAGCCTGT TTGTGAAAAA AATATGGACT ATAAATGAAG CTCAAATCAT
GAATGGCCCA TCACAAATGC TTCAAACTGC CACTATATGT GTAACATGAT TATTACTGTA GCAATTTATG TTCAAAAGCA
TCTAAACGAG TCAATGTTAA CAGTTCAATA ATATTATAGT CTCTTTTGCA TTACAGGAGG AATAAAAGTA TGATAAAGGA
GCTAAGCTCA CCTCCTGATG GTTCAAGTGA CCTATCCTTT CCAACAGAAT ACTCTCAAAC TTTCATCACA CAATGTTTGG
CTTGCCTATG GAAGCAAAGT CTGTCCTACT GGAGAAACCC TCCATATACT GCTGTCAAAT ACTTCTACAC CATTGTAATT
GCACTGTTGT TTGGAACAAT GTTCTGGGGT GTTGGCAGAA AAAGGTATAC GGTCAATAAA AACAAGTAAA AATGTATATG
CAACATTTTC CACTGATTTA GAGAGGCTAC CTTGAGATTA TATCTGTCAC AATTCACTGA GGATACTCCA CTCTTGCAGG
AGCAATCAAC AGGACTTGTT CAATGCCATG GGCTCCATGT ATGCGTCAGT TTTATTTATG GGAGTGCAGA ATTCTTCTTC
CGTTCAGCCA GTTGTGTCTG TTGAACGCAC TGTGTTCTAC AGGGAACGAG CAGCTCACAT GTATTCACCT TTGCCATACG
CCTTGGGACA GGTAAAGTTA TTTTACATTA ACTTTATTAT ACAATAGCAT TGATATTTGT ATGATAGGAA AGAGAAGATT
ATTATTTGAA GGGGAAAAAA GAGCAGCTCA ATTAACATGT AAAGCATCAA AATCAAATGG AAGCTTGTAC ATATGAGGCT
TCTAAAAGGG TTATATAAAA TATTTTAACC AGGATATAAC ACAATGGTTG AACAACTCCC GAAGTAATTG GAAGAAAATG
GTAAAAGAAA CACTATGTGC TGCTAACATA CAATTCTGTC CGCAGGTTGC AATTGAACTT CCATACATCC TTGTTCAGTC
CTTAATATAT GGTGTTCTAG TGTATGCAAT GATTGGATTT GAGTGGACAG CTGCCAAGTT CTTTTGGTAC CTGTTTTTCA
TGTATTTCAC TTTATCATAC TACACATTTT ATGGCATGAT GTCGGTGGGT CTGACTCCAA GCTATAACGT GGCCTCTGTT
GTTTCCACTG CATTCTATGC CATATGGAAC CTTTTCTCAG GATTTATAAT ACCAAGAACT GTAAGTATAC TAATATTTCA
CAAATGTCTT ATAGTAATTT CACTTATGGA GCATCTGCCT TTTCTAATAC AGCCTATTTT TTTATTGGCA GCGAATTCCA
ATATGGTGGA GATGGTACTA TTGGGTCTGC CCTGTTGCGT GGACACTCTA CGGGTTGGTA ACTTCACAGT TCGGGGATGT
AACTGACACG TTTGATAATG GTGTCCGTAT ATCTGACTTT GTCGAGAGCT ACTTTGGTTA CCATCGTGAC TTCTTGTGGG
TGGTTGCCGT GATGGTGGTC TCATTTGCCG TCCTCTTCGC CTTCCTTTTC GGGCTCTCAA TCAAGATATT CAACTTCCAG
AAGAGATAAA TTGAGGAAGG CATACCCGAG TTGTGTATAG CATGTGAATA CTAGCACATC GTAATTGTAC AGCTTGAAAG
CACATTTGTA TCACCATAAT TGTACATCTT AAAGCACATT GTGTATCCTG GAATTCATGG TACTCAGATT AACAAGTTGT
TTCATTGAGT TTTTTGC

Locus: Os09g0332700

Loading...

Locus: Os09g0332700

Loading...