Os09t0333000-00

Locus

Os09g0333000

Description

ABC transporter-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR19

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 19

Oryzabase Gene Symbol Synonym(s)

OsABCG47, OsPDR19

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 47, pleiotropic drug resistance 19

Transcript Evidence

AK355919 (DDBJ)

Protein Evidence

Q6EQ60 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Cellular Component: membrane (GO:0016020)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

ABC transporter-like (IPR003439)

ATPase, AAA+ type, core (IPR003593)

ABC-2 type transporter (IPR013525)

Plant PDR ABC transporter associated (IPR013581)

Expression Databases

TENOR (Os09t0333000-00)

Others

Oryzabase (12020)

Transcript

2506 bp

>Os09t0333000-00 ABC transporter-like domain containing protein.
TGCAGATTTTTTAGACAATTCCTAGCGCTTTTTGTTATGTCTGAGGCAACATCTGGACTT
TTCCGCTTCATTGCTTCCCTTACAAGGGATCCGGTTGTGGCAAGTACTATGGGCTCATCC
TGCATATTAATTTCTATGCTTTCAAGTGGATTCATCCTATCAAGAGAGGAAATTAAGAAA
TGGTGGATATGGGGTTACTGGATATCACCCCTTATGTATGCACTGAACACATTGGCAGTT
AATGAATTCCTAGGTAACAGCTGGAACAAGACAATATCTGGTTTTAGCGAACCACTTGGA
AGGCTAGTTCTGGAATCTCGTGGGTTTTTTCCTGAGGCCAAATGGTATTGGATTGGTGTT
GGTGCCTTGCTCGGATATGTGATTCTATTAAATGTCCTCTACACCATCTGTCTCATATTT
CTCACATTATTGAACAACAACCAGCCAATAATGTCCCAGGAAACTTTCCATAAAAAGCAA
GCTAATATCACTGGTCAAGTTTTGGAAGCACCGTCTGGAGAGCAGGCTACTGACAATACA
AGATGTACTGTGGACGTTAACAACGATGAGGCAACTTCAAACCACATGATAGGGAATTCT
AGTTCAGGAATTAAAGGAATGGTCCTTCCATTTGTACCTCTTTCCATCACGTTTGAAGAT
ATAAAATACAGTATAGACATGCCAGAGGCACTGAAAACACAAGCTACAGAGAGCCGGTTG
GAACTACTGAAGGATATTAGTGGCTCTTTTAGGCCAGGAGTACTTACAGCTCTTATGGGT
GTCAGCGGTGCAGGAAAGACAACACTATTAGATGTGTTGGCTGGAAGGAAGACTAGTGGA
TACATAGAGGGCAATATTACCATCTCTGGCTACCCAAAGAAGCAAGAAACCTTTGCTAGA
GTTTCAGGATATTGTGAACAGAATGACATCCATTCACCAAATGTAACTATTTATGAGTCC
CTTATGTTCTCTGCATGGCTCAGATTACCTACTAAAATTGATTCTGCAACAAGAAAGATG
ATTATTGAGGAGGTCATGGAGCTCGTGGAGCTTTATCCCTTAAAAGATGCTTTGGTTGGA
TTGCCTGGCGTAAGCGGATTATCAATTGAACAAAGAAAAAGGCTAACAATAGCAGTGGAA
CTAGTTGCAAACCCATCTATCATTTTCCTAGACGAACCAACATCTGGACTTGACGCACGA
GCAGCAGCCATTGTCATGAGGGCAATTAGGAATACTGTGGACACAGGAAGAACAGTTGTT
TGCACAATTCACCAGCCAAGCATTGATATATTTGAATCCTTTGATGAGCTTTTCCTAATG
AAACGAGGAGGCGAAGAGATTTATGTCGGTCCACTAGGACAACATTCATGTGAATTGATT
AGATATTTTGAGGCTATTGAAGGTGTCAGCAAGATAAAACATGGCTACAATCCTTCAACA
TGGATGTTGGAAGTGACTAGCCCAATGCAAGAACAAAAAACTGGCGTAAACTTCACTCAA
GTTTACAAGAATTCTGAACTATACAGAAGGAACAAAAATTTGATAAAGGAGTTAAGCACG
CCCCATGAAAGTTCAAGCGACTTATCATTTCCAACTCAATATTCACAGCCCTTTCTTACA
CAATGTTTGGCTTGCCTCTGGAAGCAACGTCTGTCATACTGGCGTAATCCTCGATATATT
GCTGTGAAATACTTCTTCACCATTATAGTTGCATTGTTGTTTGGAACAATGTTCTGGGGT
ATTGGCCAAAAAAGGAATAATAAACAGGCCTTGTTCAGCGCCATGGGTTCCATGTATTCT
ACATGTTTGACCATGGGAGTACAAAACTCTGCTTCAGTTCAACCAATTGTCTCTATTGAG
CGCACAGTCTTTTATAGAGAAAGAGCATCGCACATGTACTCCCCTTTGCCATATGCCTTG
GGACAGGTTGCAATTGAACTTCCGTACATCTTCCTTCAGACCATAATATATGGCATGCTA
GTGTATGCAATGATAGGATATGAGTGGTCAGGTGCCAAATTCTTTTGGTACCTTTTCTTC
ATGTACTTCACTTTGTCATACTACACATTTTACGGCATGATGGCGGTGGGTCTAACTCCA
AATTACAACATGTCCACTGTTGTTTCCACAGGATTTTATACCATGTGGAACCTTTTCTCA
GGATTTCTAATACCGTTAACTAGAATTCCTATATGGTGGAGATGGTACTATTGGATATGC
CCGGTTGCATGGACGCTCAATGGGTTGGTTACCTCACAGTTTGGGGATGTATCAGACAAG
TTTGATGATGGAGAGCGTGTATCTGACTTTGTCAAGAACTACTTTGGTTTCCATCATGAG
TTATTGTGGGTCCCGGCTATGGTAGTTGTCTCATTTGCTGTTCTTTTTGCCTTCCTTTTT
GGACTCTCACTCAGGCTATTCAATTTCCAAAAGCGATAACTAACAAAGGCATACCTGAGT
TTCAGAGTTTTAACAGAGCCTGGTTAGCAGAAATGTTACTATAGGA

CDS

2439 bp

>Os09t0333000-00 ABC transporter-like domain containing protein.
TGCAGATTTTTTAGACAATTCCTAGCGCTTTTTGTTATGTCTGAGGCAACATCTGGACTT
TTCCGCTTCATTGCTTCCCTTACAAGGGATCCGGTTGTGGCAAGTACTATGGGCTCATCC
TGCATATTAATTTCTATGCTTTCAAGTGGATTCATCCTATCAAGAGAGGAAATTAAGAAA
TGGTGGATATGGGGTTACTGGATATCACCCCTTATGTATGCACTGAACACATTGGCAGTT
AATGAATTCCTAGGTAACAGCTGGAACAAGACAATATCTGGTTTTAGCGAACCACTTGGA
AGGCTAGTTCTGGAATCTCGTGGGTTTTTTCCTGAGGCCAAATGGTATTGGATTGGTGTT
GGTGCCTTGCTCGGATATGTGATTCTATTAAATGTCCTCTACACCATCTGTCTCATATTT
CTCACATTATTGAACAACAACCAGCCAATAATGTCCCAGGAAACTTTCCATAAAAAGCAA
GCTAATATCACTGGTCAAGTTTTGGAAGCACCGTCTGGAGAGCAGGCTACTGACAATACA
AGATGTACTGTGGACGTTAACAACGATGAGGCAACTTCAAACCACATGATAGGGAATTCT
AGTTCAGGAATTAAAGGAATGGTCCTTCCATTTGTACCTCTTTCCATCACGTTTGAAGAT
ATAAAATACAGTATAGACATGCCAGAGGCACTGAAAACACAAGCTACAGAGAGCCGGTTG
GAACTACTGAAGGATATTAGTGGCTCTTTTAGGCCAGGAGTACTTACAGCTCTTATGGGT
GTCAGCGGTGCAGGAAAGACAACACTATTAGATGTGTTGGCTGGAAGGAAGACTAGTGGA
TACATAGAGGGCAATATTACCATCTCTGGCTACCCAAAGAAGCAAGAAACCTTTGCTAGA
GTTTCAGGATATTGTGAACAGAATGACATCCATTCACCAAATGTAACTATTTATGAGTCC
CTTATGTTCTCTGCATGGCTCAGATTACCTACTAAAATTGATTCTGCAACAAGAAAGATG
ATTATTGAGGAGGTCATGGAGCTCGTGGAGCTTTATCCCTTAAAAGATGCTTTGGTTGGA
TTGCCTGGCGTAAGCGGATTATCAATTGAACAAAGAAAAAGGCTAACAATAGCAGTGGAA
CTAGTTGCAAACCCATCTATCATTTTCCTAGACGAACCAACATCTGGACTTGACGCACGA
GCAGCAGCCATTGTCATGAGGGCAATTAGGAATACTGTGGACACAGGAAGAACAGTTGTT
TGCACAATTCACCAGCCAAGCATTGATATATTTGAATCCTTTGATGAGCTTTTCCTAATG
AAACGAGGAGGCGAAGAGATTTATGTCGGTCCACTAGGACAACATTCATGTGAATTGATT
AGATATTTTGAGGCTATTGAAGGTGTCAGCAAGATAAAACATGGCTACAATCCTTCAACA
TGGATGTTGGAAGTGACTAGCCCAATGCAAGAACAAAAAACTGGCGTAAACTTCACTCAA
GTTTACAAGAATTCTGAACTATACAGAAGGAACAAAAATTTGATAAAGGAGTTAAGCACG
CCCCATGAAAGTTCAAGCGACTTATCATTTCCAACTCAATATTCACAGCCCTTTCTTACA
CAATGTTTGGCTTGCCTCTGGAAGCAACGTCTGTCATACTGGCGTAATCCTCGATATATT
GCTGTGAAATACTTCTTCACCATTATAGTTGCATTGTTGTTTGGAACAATGTTCTGGGGT
ATTGGCCAAAAAAGGAATAATAAACAGGCCTTGTTCAGCGCCATGGGTTCCATGTATTCT
ACATGTTTGACCATGGGAGTACAAAACTCTGCTTCAGTTCAACCAATTGTCTCTATTGAG
CGCACAGTCTTTTATAGAGAAAGAGCATCGCACATGTACTCCCCTTTGCCATATGCCTTG
GGACAGGTTGCAATTGAACTTCCGTACATCTTCCTTCAGACCATAATATATGGCATGCTA
GTGTATGCAATGATAGGATATGAGTGGTCAGGTGCCAAATTCTTTTGGTACCTTTTCTTC
ATGTACTTCACTTTGTCATACTACACATTTTACGGCATGATGGCGGTGGGTCTAACTCCA
AATTACAACATGTCCACTGTTGTTTCCACAGGATTTTATACCATGTGGAACCTTTTCTCA
GGATTTCTAATACCGTTAACTAGAATTCCTATATGGTGGAGATGGTACTATTGGATATGC
CCGGTTGCATGGACGCTCAATGGGTTGGTTACCTCACAGTTTGGGGATGTATCAGACAAG
TTTGATGATGGAGAGCGTGTATCTGACTTTGTCAAGAACTACTTTGGTTTCCATCATGAG
TTATTGTGGGTCCCGGCTATGGTAGTTGTCTCATTTGCTGTTCTTTTTGCCTTCCTTTTT
GGACTCTCACTCAGGCTATTCAATTTCCAAAAGCGATAA

Protein

812 aa

>Os09t0333000-00 ABC transporter-like domain containing protein.
CRFFRQFLALFVMSEATSGLFRFIASLTRDPVVASTMGSSCILISMLSSGFILSREEIKK
WWIWGYWISPLMYALNTLAVNEFLGNSWNKTISGFSEPLGRLVLESRGFFPEAKWYWIGV
GALLGYVILLNVLYTICLIFLTLLNNNQPIMSQETFHKKQANITGQVLEAPSGEQATDNT
RCTVDVNNDEATSNHMIGNSSSGIKGMVLPFVPLSITFEDIKYSIDMPEALKTQATESRL
ELLKDISGSFRPGVLTALMGVSGAGKTTLLDVLAGRKTSGYIEGNITISGYPKKQETFAR
VSGYCEQNDIHSPNVTIYESLMFSAWLRLPTKIDSATRKMIIEEVMELVELYPLKDALVG
LPGVSGLSIEQRKRLTIAVELVANPSIIFLDEPTSGLDARAAAIVMRAIRNTVDTGRTVV
CTIHQPSIDIFESFDELFLMKRGGEEIYVGPLGQHSCELIRYFEAIEGVSKIKHGYNPST
WMLEVTSPMQEQKTGVNFTQVYKNSELYRRNKNLIKELSTPHESSSDLSFPTQYSQPFLT
QCLACLWKQRLSYWRNPRYIAVKYFFTIIVALLFGTMFWGIGQKRNNKQALFSAMGSMYS
TCLTMGVQNSASVQPIVSIERTVFYRERASHMYSPLPYALGQVAIELPYIFLQTIIYGML
VYAMIGYEWSGAKFFWYLFFMYFTLSYYTFYGMMAVGLTPNYNMSTVVSTGFYTMWNLFS
GFLIPLTRIPIWWRWYYWICPVAWTLNGLVTSQFGDVSDKFDDGERVSDFVKNYFGFHHE
LLWVPAMVVVSFAVLFAFLFGLSLRLFNFQKR*

CDS

chr09:10014274..10014439 (- strand) : 166 bp

chr09:10014061..10014164 (- strand) : 104 bp

chr09:10013821..10013977 (- strand) : 157 bp

chr09:10013604..10013720 (- strand) : 117 bp

chr09:10013377..10013519 (- strand) : 143 bp

chr09:10012927..10013256 (- strand) : 330 bp

chr09:10012390..10012680 (- strand) : 291 bp

chr09:10012170..10012253 (- strand) : 84 bp

chr09:10011953..10012086 (- strand) : 134 bp

chr09:10009851..10010078 (- strand) : 228 bp

chr09:10009564..10009735 (- strand) : 172 bp

chr09:10009180..10009434 (- strand) : 255 bp

chr09:10008838..10009095 (- strand) : 258 bp

3'UTR

chr09:10008771..10008837 (- strand) : 67 bp

FASTA

>Os09t0333000-00 class=Sequence position=chr09:10008771..10014439 (- strand)
TGCAGATTTT TTAGACAATT CCTAGCGCTT TTTGTTATGT CTGAGGCAAC ATCTGGACTT TTCCGCTTCA TTGCTTCCCT
TACAAGGGAT CCGGTTGTGG CAAGTACTAT GGGCTCATCC TGCATATTAA TTTCTATGCT TTCAAGTGGA TTCATCCTAT
CAAGAGGTAC GCAAACTATC TATGAAACAC CACAATGATA TGTGGATAAG TTCTTACATA ATTTCTTTAT TGGATGTGGT
ACTTTTATGA ATATAATTTG TTTTATGTTT AACAGAGGAA ATTAAGAAAT GGTGGATATG GGGTTACTGG ATATCACCCC
TTATGTATGC ACTGAACACA TTGGCAGTTA ATGAATTCCT AGGTAACAGC TGGAACAAGG TAAAAGCATA TTTATGCGAT
CAATTAAAAG CCATACATCA GAATATGTCT CGCTAAAACA TTTGCTTATC ATCACACAAT AGACAATATC TGGTTTTAGC
GAACCACTTG GAAGGCTAGT TCTGGAATCT CGTGGGTTTT TTCCTGAGGC CAAATGGTAT TGGATTGGTG TTGGTGCCTT
GCTCGGATAT GTGATTCTAT TAAATGTCCT CTACACCATC TGTCTCATAT TTCTCACATG TGAGTCATAG AAAATCTTGA
ATCTTTTATT GTTAGTAAAT AATGCTATTA TTCTAAAAGA TCTACAAATT CTAATTTTAT TGCACCATGT ACTCTGTAGT
ATTGAACAAC AACCAGCCAA TAATGTCCCA GGAAACTTTC CATAAAAAGC AAGCTAATAT CACTGGTCAA GTTTTGGAAG
CACCGTCTGG AGAGCAGGCT ACTGACAATA CAAGATGTAA ATATTTTTTT GGACCACTAA TCTAAAGTTT AAACATGAGA
TGTCAGTTTA TTGCTGATGT GCGTGTGGTA TGTGTACCAG GTACTGTGGA CGTTAACAAC GATGAGGCAA CTTCAAACCA
CATGATAGGG AATTCTAGTT CAGGAATTAA AGGAATGGTC CTTCCATTTG TACCTCTTTC CATCACGTTT GAAGATATAA
AATACAGTAT AGACATGCCA GAGGTACCCC AAATATTGCC AAGTCTACCA GACATGCATG TTCCATATGG AAAATTGCAT
CTATTTGTAC CATTTATGAG CAATCTTTGA AAAAAAATAG TCTTGACCAA ACAAAACTTG TAGGCACTGA AAACACAAGC
TACAGAGAGC CGGTTGGAAC TACTGAAGGA TATTAGTGGC TCTTTTAGGC CAGGAGTACT TACAGCTCTT ATGGGTGTCA
GCGGTGCAGG AAAGACAACA CTATTAGATG TGTTGGCTGG AAGGAAGACT AGTGGATACA TAGAGGGCAA TATTACCATC
TCTGGCTACC CAAAGAAGCA AGAAACCTTT GCTAGAGTTT CAGGATATTG TGAACAGAAT GACATCCATT CACCAAATGT
AACTATTTAT GAGTCCCTTA TGTTCTCTGC ATGGCTCAGA TTACCTACTA AAATTGATTC TGCAACAAGA AAGGTCAGAT
AAAGAAAATA CTTTCACTTT ATTCAAATAC AGAGTAGTGC ATAAAAAAGA AAATGTTGTC TGAACTGATA TAGAATGCTA
TAAATGAAAA ATAAAattga catgaatatt catagcaatg aattttttta tttcatggca gtgtatttaa catgaatatt
catgtattct tttacatgtt atccagattg tttttttaat ctttttttag ataatgttat TTTTTTATCT TATATGCAGA
TGATTATTGA GGAGGTCATG GAGCTCGTGG AGCTTTATCC CTTAAAAGAT GCTTTGGTTG GATTGCCTGG CGTAAGCGGA
TTATCAATTG AACAAAGAAA AAGGCTAACA ATAGCAGTGG AACTAGTTGC AAACCCATCT ATCATTTTCC TAGACGAACC
AACATCTGGA CTTGACGCAC GAGCAGCAGC CATTGTCATG AGGGCAATTA GGAATACTGT GGACACAGGA AGAACAGTTG
TTTGCACAAT TCACCAGCCA AGCATTGATA TATTTGAATC CTTTGATGAG GTGAATGAAA TCATACTTGT ATAGTCCATT
TTTTTCTATC ATGCAGACAT AGACAAAAGG AAAAGTAAAT TGTTGGTGGG TTATAACATC GTTTGCTGAT CCACTCAATT
CATTATAATG TTGTTAATAT TTGCAGCTTT TCCTAATGAA ACGAGGAGGC GAAGAGATTT ATGTCGGTCC ACTAGGACAA
CATTCATGTG AATTGATTAG ATATTTTGAG GTTAGAAAAA AGAATAGAAA GTAATATATG CTTGCCTTAT TGCATTGAGA
AACATGCTAT TGAATCGCTT TTATTTTCTG AAGGCTATTG AAGGTGTCAG CAAGATAAAA CATGGCTACA ATCCTTCAAC
ATGGATGTTG GAAGTGACTA GCCCAATGCA AGAACAAAAA ACTGGCGTAA ACTTCACTCA AGTTTACAAG AATTCTGAAC
TATACAGGTA ACTATATATT GGGTTGTCCT CAGGGGCGGA TCCAGGAAAA AATAGTAGTG GGGGCTGAAC AAATTACGCC
AGCATAAATC GAAACATGTC TCACATGTAA ATTGGCTAAA TGTCAGTTCA AGGTACACAT TGAATTAATG ATATGTCGAG
AATTTTGTCC ATACCAAACC AATATCGAAT AGATGACGTG TCACACCCAA TCGTCTATTA TTCTTCATGA GTAGTAATTT
ATACAAAGAA AAAGGCAAAT TAACGAATAA TCGAAACATA CTTATTTTGG ATTCAAATAA TTTAGAGATT TAGGGAGGAA
TGGAGGCATA GAGCATACCA CTAATTTCTG TTGAGGTAAT AACATCTGAC GCGCTTTCAT ATCTTCAAAT TGTTGGATGA
TTTTTTCATC CGATTGAAAA AACCCTGACT TGGGTTTCTT TGGCTAACTT AAACACTCAT TACTGGATGG AGGATCACTT
TACTGGATGG AGGATCACTG CCATTTGTGT TGCTTAAACT AAAATAATAC GTGAGCAATG TTTTTTTTGA CATGTTGACA
ATCTAAAAAT GTATAGAAAA TAATTATAAG TTTCAAGCAC AAGTGCACAA CCTCATTAAG ACACAATTTT AGACTATCTA
TTAGTATTAG AGGTTACTAG TTTACCGATT TCTAACTTCA AATCTTCAAT CACAGTCACA GTAGGCTGCG ACTGCGTCGT
TGACTCGTTG CTGCCTTGCC GGCCACTGTG CCGCTGACCT GCTGCCTGCC TGCCTCGGCG CCTTGCGCCC TCGCGGCACC
TCGCCAGCGA GCGGCTCGCC ACCTTCCCGG CGGCGTGGCG GCGCAGGCAC TGGAGTGCTG GACCACCGCC TCCGCCTGGC
CTGCCTCCTG TCTGGCCCAT CGCCGGCTCA CTGGACGCCG CCACGGCACC TTGCCGCTTG GCGCTCGCCA GCTTGCAGGC
TTGCAGCTCA CCGGAGGTCG CCACCTGCTC CGGGCATGCA CTGGACCACC GGGGCACCGC CTGGCACGCC TCCCGTCTGG
CCCCTCGCCG GACGCCACCG CCTGCTCGGC CGCCGCCCGC CGCCCGCGCC TATTCGCCTA GGGTTAGGGA TTTAGGAGAG
GAGGAGGTGG CCAGTGGGAT TGGGGAATTG GGGAGGCGGG AGGCCGGGAG GGGGAGTAGC CAAATGGGCT GGCTGGAATC
TGCCACCGTG GGCCTTTGCT TGGAGTGGGC TAGACAAAAC TTGAAGACTG CGCTCGTGGT CGTGGGCTGC TCTTCGAAAC
AAGCCCAAAT CGCGAAATAA CATCGTCTTC AACCTCCAGC CTTCCCTCCA GCCAACCTGA CGAAGCTCCA GCCACCACAT
CTCgtgaaaa attttagtgg gggcttaggg gggtctccat ggaccctggg gcggtagtgg ggtctcaaga cccccccgcc
cccatggcaa atccgcccct gGTTGTCCTT CAGTTAATAT AGTTTGATCA TGGAACTATA ATGGTTGCCC CACTAACATA
ACACCTAAGA TCAAAGCGAA CTTTACTCCA TGCACCAAAT GACTGGCTCC ATAACGCTAT AAGTGAGAAG TGTGTCCAAG
TTGGTGGCAT ATGCAAAATA TTATGTTCTA TACTAAGATA TGAAAAACAC AAATACAACA TTCCAAAAGG ACAATAATGT
AATTTTTTTA TTTTCCATTT GTAATAACTA GACAAGGTAA CAGCAAATGA AAAAAAATTG AAATGCAGAT AATCCTGAAA
TCATAATATT GAATTGGATA TGCTTCAAGT TATCACCAAG TGCCACAATT TTTCAATTTT ATGAAGAAGG CAATAGGAAA
TGTTATCATT TGACCATGTC GGTACTTTGC TTTCATTACA GAAGGAACAA AAATTTGATA AAGGAGTTAA GCACGCCCCA
TGAAAGTTCA AGCGACTTAT CATTTCCAAC TCAATATTCA CAGCCCTTTC TTACACAATG TTTGGCTTGC CTCTGGAAGC
AACGTCTGTC ATACTGGCGT AATCCTCGAT ATATTGCTGT GAAATACTTC TTCACCATTA TAGTTGCATT GTTGTTTGGA
ACAATGTTCT GGGGTATTGG CCAAAAAAGG TAACAAAGTA ATATAAAAAC CACAAGAAAA TAGTGCGTAT ACAATCTTTT
ACATATTCAA AGGCTGCCTC TAGTTCATCT ATTGCCATTT ACTAGATATA TTCCACTGTT GCAGGAATAA TAAACAGGCC
TTGTTCAGCG CCATGGGTTC CATGTATTCT ACATGTTTGA CCATGGGAGT ACAAAACTCT GCTTCAGTTC AACCAATTGT
CTCTATTGAG CGCACAGTCT TTTATAGAGA AAGAGCATCG CACATGTACT CCCCTTTGCC ATATGCCTTG GGACAGGTTA
AATTCTTCGA CATATGAGTC TCTTATAATG TTGTAAGATA CTACTCAATT TCATCAGCAA TCCCCTCAGT ATGGGGAAAC
TAATGGCCAG ACAATAAGCC CTATTAACAT ATAGTTCCAT TGCAGGTTGC AATTGAACTT CCGTACATCT TCCTTCAGAC
CATAATATAT GGCATGCTAG TGTATGCAAT GATAGGATAT GAGTGGTCAG GTGCCAAATT CTTTTGGTAC CTTTTCTTCA
TGTACTTCAC TTTGTCATAC TACACATTTT ACGGCATGAT GGCGGTGGGT CTAACTCCAA ATTACAACAT GTCCACTGTT
GTTTCCACAG GATTTTATAC CATGTGGAAC CTTTTCTCAG GATTTCTAAT ACCGTTAACT GTAAGTGAAC CAGCTTTTCA
AAAATATCTA GCCAAATTAT CTTAAAGCCA TTGATTTTCC TAATATGGCT CTTTTTATCT ACAGAGAATT CCTATATGGT
GGAGATGGTA CTATTGGATA TGCCCGGTTG CATGGACGCT CAATGGGTTG GTTACCTCAC AGTTTGGGGA TGTATCAGAC
AAGTTTGATG ATGGAGAGCG TGTATCTGAC TTTGTCAAGA ACTACTTTGG TTTCCATCAT GAGTTATTGT GGGTCCCGGC
TATGGTAGTT GTCTCATTTG CTGTTCTTTT TGCCTTCCTT TTTGGACTCT CACTCAGGCT ATTCAATTTC CAAAAGCGAT
AACTAACAAA GGCATACCTG AGTTTCAGAG TTTTAACAGA GCCTGGTTAG CAGAAATGTT ACTATAGGA

Locus: Os09g0333000

Loading...

Locus: Os09g0333000

Loading...