Os09t0360900-01

Locus

Os09g0360900

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ABCA6

CGSNL Gene Name

ABC TRANSPORTER A FAMILY MEMBER 6

Oryzabase Gene Symbol Synonym(s)

OsABCA6

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCA subgroup member 6

Transcript Evidence

AK119274 (DDBJ, Best hit)

Protein Evidence

B8BES4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-130-B06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0360900-01)

Others

Oryzabase (11951)

Transcript

3556 bp

>Os09t0360900-01 Conserved hypothetical protein.
AATCGGTTTAACTCAAAATCCCAACTCCGAACGCCTCTTCTTCTcctcaccgccgccgaa
gcgtagcggctactccccatctgcctccgcctccgcctctcccatggatgatgacgattc
cgcGAGGAGGAGGGGGAGGAGCCCCGCCAGCTTCTCCACCCAGGCCTCCGCCCTCCTCCG
CAAGAACCTCTGCTTCCAGGAAAGCCGCACCGATTGATCCCTTCTCTGTGTCTGCCTTGC
TGCCCGCGACGTGTTTGTGGATATGCCTGCCCGGTTCTTATGGTTTAATCATGCTGCTCT
GGTTTGGGGCTTTTGGATGGATGATGGGCAGCCATCGATTTCATCTGTGTTCTTGGGAGG
GTGGGAGGCATATGGTTGATGGTTTTTGGTGGTGGCATCTGATTCTTGTCTCTTTGGCTG
CGGGTGCAGAGGCGGAACCTGAAGACGAACGTCGGCATCACCGTCTTCCCGATCCTCATC
TGCGTGCTGCTCGTCGTGCTTCAGAACGTGATCAACGGGGAGCTCGACAAGCCCAAGTAC
CAGTGCGGCTGCGAATGCACCGAGAGTGACCTGGATGGGACCTGCCTGCGGAAGGAGTGC
GGCATCCAGCACTCGACGCTGGAGCAGGTATGGAGCTGCGAGGTGCCCAGCCCACCACGG
TGGCCGGCCCTGATTCAGGTCCCCTGGCCAGGGTTCCGGGCTGTCGGGACCGCATCGCAG
CCGTTCGACGATTTGCCTAACCCATTGTGCCGTGGCGACGGGTCTTGCCCTGTCACTCTC
CTCGTCACTGGAGAGAACCAAACATTAGCTGAGCGTGTTTCAGGTCGGGTGTTTCCTGCC
CTTTATCCGTTGCCTAATGTGACAGACTACCTGATGCCTCCTCCCTTTTCTCCCTCTCAA
GTGACAGACTATCTTGATATCCTCTCCAGGATAGTTGTTGGTTCAGACACACAGCCATGG
TATACCCAATTGCTAGAGCCCGCTTTTTCCTCTGGTAAAACTTTGCATCTTCTCCAGCCT
CGTTGCATGCCCTTCATGTTTGGGACCATTCCATACAATGCAGGGGGCGTACCCTTACAT
ATCGATATACAGTGTATTGAAGTTCAGATGTTGTGGCGTGAAAGTGCATCAGTTATCAAC
TATGAACTGTTTAAGGGTTACGTACAAAGAGGAGGAGAAACAAATGAGTTTGTTGCAGGT
TATGACTTCTTGAACACGACAGGATATGACCTCAATATAAATGTTTGGTACAACTCTACT
TATAATGATAACACTGCATATTCATTTATCGCAGCATTACGAGTTCCACGATTGGTGAAT
GCAATATCCAATGCATACCTAAAATTTATCAGAGGAAGTGGGGTGGATATGCTGCTTGAA
TATGTAAAAGAGATGCCCAAAGTTGGAACAAGGTTTAGGCTTGATCTCTCTTCTCTTCTC
AGTGTGCTATTCTTCACATGGATAGTTGAACTACTTTTCCCAGTTATGTTGACATATCTG
GTGTATGAGAAGGAACAAAAGCTAAAAATTATGATGAAGATGCATGGTCTGAAGGATGGG
CCTTACTGGCTAATTTCTTATGCTTATTTCTTTGCTCTATCGGTTATCTATATGACATTT
TTTGTGATTTTTGGCTCCTTAATTGGTAATTTTCTTCCAATCTATTTTCACGAAGATTGC
ACTTGCATTTTTTGTGGCATCTTTCTTTTCATCTGTCAAGACAGCCACTGTGATTGGATA
CATTTATGTATTTGGCTCTGGCTTGCTAGGGGCATTTCTTTTTCGTTTCTTTGTTGAGGA
CAGGACCTTTCCCAATGGTTGGTTGTTAGTAATGGAGATTGTCCCAGGATTTTCCCTCTA
TCGAGGACTATATGAACTTGGCCAATATGCTTTCTCTGGAAGTGCTATGGGAGCCTCTGG
CATGACATGGGGAAATTTGAGAGACCCAATCAATGGAATGTGTGGTATATTTATCATCAT
GACAGTAGAATGGGCATTTCTCCTTATGTTAGCATTCTATTTGGATCAAGTCTCTCCAGT
AGGTGGTGGTGTCAGGAAAAGGCCCTTATTCTTCTTCAGGTGTTTACAGAAGAAGCACAC
ACCGTCATTGCAGAAGCCTAGCTTTGTGCAACAGGGTTCTAAAGTAATTGTCGATATGGA
GAAGCCAGATGTTGCTCAAGAAAGAGAAGTAGTTGAGCAACTTTTGGTAGGCCGCAATGC
AAATCAAGCTATTATATGTCACAACCTCAAGAAGATCTATCCTGGAAGGGATGGAAACCC
TGATAAGCTGGCGGTTCGAGGATTATCTCTTGCCGTACCAAAAGGGCAGTGCTTTGGAAT
GCTTGGCCCAAATGGAGCTGGGAAAACATCCTTCATTAGTATGATGATTGGGCTTGTTAA
ACCTACATCTGGTACTTCCTATGTTCATGGAATGGATATCAATATGGATATGGATCACAT
ATATACAAACATGGGGGTGTGCCCACAGCATGACTTACTTTGGGAACCATTGACTGGAAA
AGAACATCTGTTCTTTTATGGCAGGCTGAAGAATCTTAAAGGTGCTGTGTTGGTGAAGGC
TGTTGAGGATGCTCTGAAGAGCGTAAATCTGTTCCATGGTGGTGTTGGTGATAAGCAAGT
GGGAAAGTACAGCGGAGGCATGAAAAGAAGGCTCAGTGTGGCAATATCATTGATTGGAGA
CCCCAAAGTCGTTTTCATGGATGAACCAAGCACTGGGCTAGACCCCGCATCAAGAAATAA
CTTGTGGAATGTTGTGAAGGAGGCCAAGCGAAACCGTGCGATCGTTCTTACTACGCACTC
GATGGAGGAGGCTGAAGTACTTTGTGATCGACTTGGCATCTTTGTCGATGGCGATTTCCA
ATGTCTTGGAAATCCTAAGGAGCTAAAGGCGAGATATGGGGGAGCATACATATTCACAAT
GACAACATCTCCAGACCAAGAACAAGAGGTTGAACGGCTAGTTCATGACTTGTCTCCGAG
CGCAAATAAGATCTACCACCTATCTGGAACTCAAAAGTTCGAGCTGCCAAAGCAAGAGGT
GAAAATAGCCGAGGTATTTCGCGCAGTTGAGGATGCGAAGAAACGGTTCACCGTGCATGC
CTGGGGCCTGGTTGATACCACCTTGGAGGATGTCTTCATAAAGCATATATGATTCTTTAA
AGTTCGAGCTGCCAAAGCAAGAGGTGAAAATAGCCGAGGTATTTCGCGCAGTTGAGGATG
CGAAGAAACGGTTCACCGTGCATGCCTGGGGCCTGGTTGATACCACCTTGGAGGATGTCT
TCATAAAGGTTGCCAAGGGAGCAAAGGCATCCAGTGATAATAGTTAGTTTGTGCATTGAT
AATATTGTGAGATTTATAGGCCGACTAATATTCTTTTATGTCTTGACTTTAGCATATATG
ATTCTTTTGTGGTTGTACAGAAACATATTATTCTCATACATCAGAAAAAAAAGTAACCAT
ATGTAACATTTTTGTTTATTTTAAATGTACAAATGACTCAATATATCATTGCAGATATGC
GGGAATTACAAAATAT

CDS

1395 bp

>Os09t0360900-01 Conserved hypothetical protein.
TTCTTGTCTCTTTGGCTGCGGGTGCAGAGGCGGAACCTGAAGACGAACGTCGGCATCACC
GTCTTCCCGATCCTCATCTGCGTGCTGCTCGTCGTGCTTCAGAACGTGATCAACGGGGAG
CTCGACAAGCCCAAGTACCAGTGCGGCTGCGAATGCACCGAGAGTGACCTGGATGGGACC
TGCCTGCGGAAGGAGTGCGGCATCCAGCACTCGACGCTGGAGCAGGTATGGAGCTGCGAG
GTGCCCAGCCCACCACGGTGGCCGGCCCTGATTCAGGTCCCCTGGCCAGGGTTCCGGGCT
GTCGGGACCGCATCGCAGCCGTTCGACGATTTGCCTAACCCATTGTGCCGTGGCGACGGG
TCTTGCCCTGTCACTCTCCTCGTCACTGGAGAGAACCAAACATTAGCTGAGCGTGTTTCA
GGTCGGGTGTTTCCTGCCCTTTATCCGTTGCCTAATGTGACAGACTACCTGATGCCTCCT
CCCTTTTCTCCCTCTCAAGTGACAGACTATCTTGATATCCTCTCCAGGATAGTTGTTGGT
TCAGACACACAGCCATGGTATACCCAATTGCTAGAGCCCGCTTTTTCCTCTGGTAAAACT
TTGCATCTTCTCCAGCCTCGTTGCATGCCCTTCATGTTTGGGACCATTCCATACAATGCA
GGGGGCGTACCCTTACATATCGATATACAGTGTATTGAAGTTCAGATGTTGTGGCGTGAA
AGTGCATCAGTTATCAACTATGAACTGTTTAAGGGTTACGTACAAAGAGGAGGAGAAACA
AATGAGTTTGTTGCAGGTTATGACTTCTTGAACACGACAGGATATGACCTCAATATAAAT
GTTTGGTACAACTCTACTTATAATGATAACACTGCATATTCATTTATCGCAGCATTACGA
GTTCCACGATTGGTGAATGCAATATCCAATGCATACCTAAAATTTATCAGAGGAAGTGGG
GTGGATATGCTGCTTGAATATGTAAAAGAGATGCCCAAAGTTGGAACAAGGTTTAGGCTT
GATCTCTCTTCTCTTCTCAGTGTGCTATTCTTCACATGGATAGTTGAACTACTTTTCCCA
GTTATGTTGACATATCTGGTGTATGAGAAGGAACAAAAGCTAAAAATTATGATGAAGATG
CATGGTCTGAAGGATGGGCCTTACTGGCTAATTTCTTATGCTTATTTCTTTGCTCTATCG
GTTATCTATATGACATTTTTTGTGATTTTTGGCTCCTTAATTGGTAATTTTCTTCCAATC
TATTTTCACGAAGATTGCACTTGCATTTTTTGTGGCATCTTTCTTTTCATCTGTCAAGAC
AGCCACTGTGATTGGATACATTTATGTATTTGGCTCTGGCTTGCTAGGGGCATTTCTTTT
TCGTTTCTTTGTTGA

Protein

464 aa

>Os09t0360900-01 Conserved hypothetical protein.
FLSLWLRVQRRNLKTNVGITVFPILICVLLVVLQNVINGELDKPKYQCGCECTESDLDGT
CLRKECGIQHSTLEQVWSCEVPSPPRWPALIQVPWPGFRAVGTASQPFDDLPNPLCRGDG
SCPVTLLVTGENQTLAERVSGRVFPALYPLPNVTDYLMPPPFSPSQVTDYLDILSRIVVG
SDTQPWYTQLLEPAFSSGKTLHLLQPRCMPFMFGTIPYNAGGVPLHIDIQCIEVQMLWRE
SASVINYELFKGYVQRGGETNEFVAGYDFLNTTGYDLNINVWYNSTYNDNTAYSFIAALR
VPRLVNAISNAYLKFIRGSGVDMLLEYVKEMPKVGTRFRLDLSSLLSVLFFTWIVELLFP
VMLTYLVYEKEQKLKIMMKMHGLKDGPYWLISYAYFFALSVIYMTFFVIFGSLIGNFLPI
YFHEDCTCIFCGIFLFICQDSHCDWIHLCIWLWLARGISFSFLC*

5'UTR

chr09:11779735..11780136 (+ strand) : 402 bp

CDS

chr09:11780137..11780548 (+ strand) : 412 bp

chr09:11780665..11780789 (+ strand) : 125 bp

chr09:11780890..11781034 (+ strand) : 145 bp

chr09:11781450..11781563 (+ strand) : 114 bp

chr09:11781821..11781945 (+ strand) : 125 bp

chr09:11782039..11782197 (+ strand) : 159 bp

chr09:11782303..11782495 (+ strand) : 193 bp

chr09:11782617..11782671 (+ strand) : 55 bp

chr09:11782751..11782817 (+ strand) : 67 bp

3'UTR

chr09:11782818..11782834 (+ strand) : 17 bp

chr09:11782912..11783279 (+ strand) : 368 bp

chr09:11783364..11783564 (+ strand) : 201 bp

chr09:11783660..11783769 (+ strand) : 110 bp

chr09:11783864..11783948 (+ strand) : 85 bp

chr09:11784111..11784239 (+ strand) : 129 bp

chr09:11784331..11784436 (+ strand) : 106 bp

chr09:11784556..11784644 (+ strand) : 89 bp

chr09:11784719..11784979 (+ strand) : 261 bp

chr09:11785084..11785476 (+ strand) : 393 bp

FASTA

>Os09t0360900-01 class=Sequence position=chr09:11779735..11785476 (+ strand)
AATCGGTTTA ACTCAAAATC CCAACTCCGA ACGCCTCTTC TTCTcctcac cgccgccgaa gcgtagcggc tactccccat
ctgcctccgc ctccgcctct cccatggatg atgacgattc cgcGAGGAGG AGGGGGAGGA GCCCCGCCAG CTTCTCCACC
CAGGCCTCCG CCCTCCTCCG CAAGAACCTC TGCTTCCAGG AAAGCCGCAC CGATTGATCC CTTCTCTGTG TCTGCCTTGC
TGCCCGCGAC GTGTTTGTGG ATATGCCTGC CCGGTTCTTA TGGTTTAATC ATGCTGCTCT GGTTTGGGGC TTTTGGATGG
ATGATGGGCA GCCATCGATT TCATCTGTGT TCTTGGGAGG GTGGGAGGCA TATGGTTGAT GGTTTTTGGT GGTGGCATCT
GATTCTTGTC TCTTTGGCTG CGGGTGCAGA GGCGGAACCT GAAGACGAAC GTCGGCATCA CCGTCTTCCC GATCCTCATC
TGCGTGCTGC TCGTCGTGCT TCAGAACGTG ATCAACGGGG AGCTCGACAA GCCCAAGTAC CAGTGCGGCT GCGAATGCAC
CGAGAGTGAC CTGGATGGGA CCTGCCTGCG GAAGGAGTGC GGCATCCAGC ACTCGACGCT GGAGCAGGTA TGGAGCTGCG
AGGTGCCCAG CCCACCACGG TGGCCGGCCC TGATTCAGGT CCCCTGGCCA GGGTTCCGGG CTGTCGGGAC CGCATCGCAG
CCGTTCGACG ATTTGCCTAA CCCATTGTGC CGTGGCGACG GGTCTTGCCC TGTCACTCTC CTCGTCACTG GAGAGAACCA
AACATTAGCT GAGCGTATGT GTCATATTTT CCATATTGCT GATCGATTGC TAAAATGAAT ACTTGAACTT TTCATATTTC
AAAAAATTAG GTGAATGTGT TCATAGTTCT TGAGTACTTC CAATTGACAG GTGTTTCAGG TCGGGTGTTT CCTGCCCTTT
ATCCGTTGCC TAATGTGACA GACTACCTGA TGCCTCCTCC CTTTTCTCCC TCTCAAGTGA CAGACTATCT TGATATCCTC
TCCAGGATAG TTGTTGTGAG TTCCTTCGAT GGCTGCATGA GTATACATCT TGTAGATCAC GCTTTTTTCT TGAAAAATAG
CTTATGGAGT TATTGGTTGG ACTGATTTGT CATAGGGTTC AGACACACAG CCATGGTATA CCCAATTGCT AGAGCCCGCT
TTTTCCTCTG GTAAAACTTT GCATCTTCTC CAGCCTCGTT GCATGCCCTT CATGTTTGGG ACCATTCCAT ACAATGCAGG
GGGCGTACCC TTACATATCG GTAAGTTAAA GCTTCCTTCT TTGCAATGTT GAATTTGTGA CTTGTGTTGA AAAACTTAAG
TTACTTTGCT AGTAAGTCAG GCTAGGGATG CAAATATGCA ATTCAAAACT TTTCCTGTAC AAATTCATTT ACATTTGAAG
GGACTAAAAA ATATTTTCCT GTTCTGTTAT TCATTTTGCA TGGTTTCTAC TTTCAATACA ATCAAACAGA AACAAGACAA
CTAGTTTTTT TAGATAATGG AATATAGTAG TTGTGTGGTG AGACTTGTAC ATGTCTAGTA CGTTGTGTAG TGTAGCTTTT
CCTAACTATT TATGCAGTCT GTTTGACAAC AATAAATACA ATATGTTCAT CGTTCATTTA GACTCTTTCG TAGGGCTGCC
TAGATTGTAT TCTGATGTCC TGTTGAATGA ACCAGATATA CAGTGTATTG AAGTTCAGAT GTTGTGGCGT GAAAGTGCAT
CAGTTATCAA CTATGAACTG TTTAAGGGTT ACGTACAAAG AGGAGGAGAA ACAAATGAGT TTGTTGCAGG TTATCTTTCT
ATCTCAATGT GACCATTTTG TGGTCAATTT GCAACCAGAA TGAGTTTGTG TAACAGTGGT TTTTTTTCAC ATTTTGAATT
TGAATACCTT CCAACAGACT GCTTTTGAAT GCCACACATA GTACAGATAA TTCCATGGCC CCATCTCCAA ATAATTGCTT
CAAAACATAA CAAATGTAGT TTTTCGTATA AATGGTGGTG GTTATTTGCA ATGATGTGTG CTGTATAGTT TAATTGTTCT
CTGCAGGTTA TGACTTCTTG AACACGACAG GATATGACCT CAATATAAAT GTTTGGTACA ACTCTACTTA TAATGATAAC
ACTGCATATT CATTTATCGC AGCATTACGA GTTCCACGAT TGGTGAATGC AGTATGTTTT CCTTTTCATA ACTTCGTCCT
GAGTAATTTC GGTGTATTAC AGAACCATCT GACAATTCAG CAATTTATGC TTTGTTTCCT GCAGATATCC AATGCATACC
TAAAATTTAT CAGAGGAAGT GGGGTGGATA TGCTGCTTGA ATATGTAAAA GAGATGCCCA AAGTTGGAAC AAGGTTTAGG
CTTGATCTCT CTTCTCTTCT CAGTGTGCTA TTCTTCACAT GGATAGTTGA ACTACTTTTC CCAGTGAGTA TGATGTGATT
TAACAAGTTC AGATGCAAAA GAAAAAGGGA GTGTTGAGTG TGTTATGGTC AGGATTTGTA CAGCTTGCAA ATTGACTCTC
TTTTCCAGGT TATGTTGACA TATCTGGTGT ATGAGAAGGA ACAAAAGCTA AAAATTATGA TGAAGATGCA TGGTCTGAAG
GATGGGCCTT ACTGGCTAAT TTCTTATGCT TATTTCTTTG CTCTATCGGT TATCTATATG ACATTTTTTG TGATTTTTGG
CTCCTTAATT GGTAATTTTC TTCCAATCTA TTTTCACGAA GGTGCTGTTC TGACAAATAA ATCTAGATAT TTCAATAGAT
TTTTTTTGTA GGTCTAAATT TCTTCAGACT CAATGACTAC AGCATACAGT TTGCTTTCTT CTTCATTTAT ATAAATTTGC
AGATTGCACT TGCATTTTTT GTGGCATCTT TCTTTTCATC TGTCAAGACA GCCACTGGTT AGTGATTCAA CCTTGTAAGT
TATAAGTCCA AAATGTTTCT TACTGGAAGT CACAAATTAC ATATTTCCTC CTGCAGTGAT TGGATACATT TATGTATTTG
GCTCTGGCTT GCTAGGGGCA TTTCTTTTTC GTTTCTTTGT TGAGGACAGG ACCTTTCCCA GTAAGTTATT ATATCTGTTG
TATTTTTCAA CTTAATTTAC ATAATATGGG TAACAAGCAT TTTTGTTTTC TACTCAGATG GTTGGTTGTT AGTAATGGAG
ATTGTCCCAG GATTTTCCCT CTATCGAGGA CTATATGAAC TTGGCCAATA TGCTTTCTCT GGAAGTGCTA TGGGAGCCTC
TGGCATGACA TGGGGAAATT TGAGAGACCC AATCAATGGA ATGTGTGGTA TATTTATCAT CATGACAGTA GAATGGGCAT
TTCTCCTTAT GTTAGCATTC TATTTGGATC AAGTCTCTCC AGTAGGTGGT GGTGTCAGGA AAAGGCCCTT ATTCTTCTTC
AGGTGTTTAC AGAAGAAGCA CACACCGTCA TTGCAGAAGC CTAGCTTTGT GCAACAGGGT TCTAAAGTAA TTGTCGATAT
GGAGAAGCCA GATGTTGCTC AAGAAGTAGG TTACCTGCTA TACTTTGCCA GTCCAGATTT AATGGAGTAC ATATGTTCTA
AATTTATTCA TTATACAAAT TCTATCCAGA GAGAAGTAGT TGAGCAACTT TTGGTAGGCC GCAATGCAAA TCAAGCTATT
ATATGTCACA ACCTCAAGAA GATCTATCCT GGAAGGGATG GAAACCCTGA TAAGCTGGCG GTTCGAGGAT TATCTCTTGC
CGTACCAAAA GGGCAGTGCT TTGGAATGCT TGGCCCAAAT GGAGCTGGGA AAACATCCTT CATTAGTATG GTATAGTACT
AAAATGGCAC GTGGTACCAT TTTTTGTGAA AATTGCTTAG TTGTGGCAGC TCACCTTTAT TAACCTTGTT TTGTTATTTT
ACCAGATGAT TGGGCTTGTT AAACCTACAT CTGGTACTTC CTATGTTCAT GGAATGGATA TCAATATGGA TATGGATCAC
ATATATACAA ACATGGGGGT GTGCCCACAG CATGAGTATT TGCTACAACT AGCACTTATC TGACCAAAAA GAATCTTTCC
CAGACCAGAT TATTTTTTTT ATAGTAATAC GTTTTAATCT GAAATGCAGC TTACTTTGGG AACCATTGAC TGGAAAAGAA
CATCTGTTCT TTTATGGCAG GCTGAAGAAT CTTAAAGGTG CTGTGTTGGT GAAGGTACCT CTACTCTGCC TCACTTATTT
TTAAATTTAA TATCCACATT TCATTGTTGA CCATATGAAG TTGTTTTGTC ACGTATTTCA TAAACTATAC TGCTCAGCTA
TCTCAGCATA TGTACATCTT GTATTTGAAC CATGTCTGGG ATTTTTCCAC TGTTAGGCTG TTGAGGATGC TCTGAAGAGC
GTAAATCTGT TCCATGGTGG TGTTGGTGAT AAGCAAGTGG GAAAGTACAG CGGAGGCATG AAAAGAAGGC TCAGTGTGGC
AATATCATTG ATTGGAGACC CCAAAGTACT TTTCTGTATA TTTTTTTAAC CCTTCCATAG GATGTCCTTT TGTTCTTTTG
TTAATGTGTT ATGCAACCTG ACAACACATT CTGTAGGTCG TTTTCATGGA TGAACCAAGC ACTGGGCTAG ACCCCGCATC
AAGAAATAAC TTGTGGAATG TTGTGAAGGA GGCCAAGCGA AACCGTGCGA TCGTTCTTAC TAGTACTTAT CCTTTTCCCT
TTCTACTTTC GCGTCCAATT CTTAGATTCC TAACGCGTCA CTTATTGATT TTAAAATTTA CAAGAGTATC AAATAGTGTT
GATCAAATGT GATTCTCGCA GCGCACTCGA TGGAGGAGGC TGAAGTACTT TGTGATCGAC TTGGCATCTT TGTCGATGGC
GATTTCCAAT GTCTTGGAAA TCCTAAGGAG GTACATTTTA TTGCCTTCTT GAATCACACT GTGTGCTTTA TGACCAGATC
TAAAACCTCA TTTGCACAAT GCAGCTAAAG GCGAGATATG GGGGAGCATA CATATTCACA ATGACAACAT CTCCAGACCA
AGAACAAGAG GTTGAACGGC TAGTTCATGA CTTGTCTCCG AGCGCAAATA AGATCTACCA CCTATCTGGA ACTCAAAAGT
TCGAGCTGCC AAAGCAAGAG GTGAAAATAG CCGAGGTATT TCGCGCAGTT GAGGATGCGA AGAAACGGTT CACCGTGCAT
GCCTGGGGCC TGGTTGATAC CACCTTGGAG GATGTCTTCA TAAAGGTTGC CAAGGGAGCA AAGGCATCCA GTGTTAATAG
TTAGTTTGTG CATTGATAAT ATTGTGAGAT TTATAGGCCG ACTAATATTC TTTTATGTCT TGACTTTAGC ATATATGATT
CTTTAAAGTT CGAGCTGCCA AAGCAAGAGG TGAAAATAGC CGAGGTATTT CGCGCAGTTG AGGATGCGAA GAAACGGTTC
ACCGTGCATG CCTGGGGCCT GGTTGATACC ACCTTGGAGG ATGTCTTCAT AAAGGTTGCC AAGGGAGCAA AGGCATCCAG
TGATAATAGT TAGTTTGTGC ATTGATAATA TTGTGAGATT TATAGGCCGA CTAATATTCT TTTATGTCTT GACTTTAGCA
TATATGATTC TTTTGTGGTT GTACAGAAAC ATATTATTCT CATACATCAG AAAAAAAAGT AACCATATGT AACATTTTTG
TTTATTTTAA ATGTACAAAT GACTCAATAT ATCATTGCAG ATATGCGGGA ATTACAAAAT AT

Locus: Os09g0360900

Loading...

Locus: Os09g0360900

Loading...