Os09t0362900-01

Locus

Os09g0362900

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET35, SDG727, OsSUVH6

Oryzabase Gene Name Synonym(s)

SET protein 35, SUVH Histone Methyltransferase 6

Transcript Evidence

AK067187 (DDBJ, Best hit)

Protein Evidence

B8BET7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Post-SET domain (IPR003616)

Pre-SET domain (IPR007728)

Full-length cDNA

J013096C06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0362900-01)

RiceXPro (AK067187)

Others

Oryzabase (13398)

KEGG (Os09t0362900-01)

Transcript

2966 bp

>Os09t0362900-01 SET domain containing protein.
GCTGTGAATTCGAGAGAAAGGAAGTTACTAGCGATCGGGATGGCCGAGAGACGGAAAGTA
GAGTAGGTGTTGGTCAATTAGAGAGGACAAATGATGTACATGATGGTGGCAGAAAAAAGA
GGTGGTTGATGTCAGTTCTGAATCCTCCACCCAAAAGAAGGGCGATCTCAGCCATACGCA
AATTTCCACGTGACTGTGGGAGGGCTGCTTCTACTCTTGCGGAAAGTGGTGCCTCTATGG
AGGAGTTGCCTTTAGAAGCAACACCTATTAGTGTAGCTACCGGTGGTGCCTCTATGGAGG
ATTCCTTGGCGAGAACCCCTATTTCAGTCCAGGGTGCTTCTTTGGTGTGCGGTCTAGACC
ATTCTAGTGAGGCAATAGATGGCAAGACAATTGAAGATGATGAATCTAGCAAGGTAGAAA
ATAGGATCCAAGAGTTCCAAGTTGCCACAAATGTTGCCCTAGATGATTTTGAAGGAGCCA
AGAATGGTAGTACACACCCAAATGATTCTATTGCCAAACCTTCTCCTAGCCATGGTTTTG
TTGAGAGGGTGAATGGAAAGGGATCACAACAAGAAAAGAAGCTTGTAGCACGAAGTGCTG
GGGATGGCAAGATGGTAAGCAAATATGAAGAGAGATTACAAAAAGGTACTCCCGAGACTC
GTATGAGAGATCTTGTCGATGTAAAGGCAAAAAAGAAGATATTAAAGAGTGATAAGATGA
ATGGGGCATTGCAAAATGACGCTAGATCCTCTGGAGATGGTAAGATGAAAACGAAGGCTT
CAAGCACTCAGAGAGGTGTGGTGCGCTCGGATATGAGCTTGAAGCAAGGTGATATTGCTC
GTAAGGTTGATGCCACAGGCAAATGCAAGGGCGGCGTGAATAGCCTCATAAAGGAGGCTA
CATCTGGGAAGCATGCTACGACTAATGGAATTGAAGAAAATGATGATAGAGACCTTGTCA
GTGACAGGATAATTGTACAAGCACTAATGGCCCCAGACAAATGCCCGTGGACACGAAGAA
GGAAGTCTATTGGTGGTTCCTCCGAGTCTCGTACTCCTAAGCTTAAGAAAAAGTTTGGTA
GGCCAAGGAAAGAATTGAAAGATACTACTCCAAGGGAAGAAGTTTCCCCGGAAGTTGCCT
CTTGTAAAGCGATCAAGCATGAGGCCATAGAGGACAAGGAGGATTCTTACTTTGAGGATG
AAGGCAACTCTAAGGCTTCTTACTCGGATGTTGAAGGCAACTCTAAGGAGCTAGTGCGTG
GAGGAAAGGCACTAGTTGTTTGTGGAGGAAAGAAGGAGTTATGTGTTACACTCCCTCCTT
CGGCTCCTTTTGGCACAGATCCCCGAAGCAAAATAAGGAATTTACTCATAAAATTCCATG
CGGCATGCCGAAAGCTTGTGCAAGTTGAGGAACAACATAAAGGTAATATTGGAAGAATTG
ACATCGAGGCTGGTAAAGCCCTAAAACAAAACGGTTTTATTAAGCCCGGACCTATTGTTG
GCAATGTTGCGGGAGTTGAAGTTGGAGATGAGTTTAATTTTAGAATCGAATTGTCATTTG
TTGGACTCCATCGCCCATATCAAGGAGGTATTGACAGTACAAAGGTGAATGGAATCCTCG
TTGCTATAAGTATTGTTGCTTCCGGAGGTTATCATGATGAATTGTCTAGCTCCGATGAAC
TCATATATACGGGTTCTGGAGGAAAGGCCATCGGGAATAAGGCAGCTGGAGATCAAAAGC
TTGAGCGTGGTAATCTAGCTTTGAAGAATTCTATTGAAACTAAGACTCCGGTCCGAGTGA
TTCATGGATTCAAAGGTCATAGTAAAGGTGAAGCTAGCCATTCTAAATCCAAGCAAATCT
CAACATATATTTATGATGGGCTGTACATGGTGGTGGATTATTGGAAAGAAGGCCCAGAGG
GCTCGATGGTCTACAAGTACAAGTTGCAAAGGATCCCAGGTCAACCCGAGTTAGCATTAC
ACATAATCAAGGCAACGAGGAAGTCCAAAGTTCGCGAAGGTGTTTGTGTGCCTGATATAT
CTCAAGGAAGGGAGAGGATTCCCATACCTGCGATCAACACAATTGACGATACGCAGCCAA
CAGCATTTAAGTACACTACGGAAGTCATATATCCACATTCCTATGCAAAAGAACCTCTGA
AAGGCTGTGATTGCACGAATGGTTGCTCAGACTCTAATAGATGTGCCTGTGCAGTGAAGA
ATGGAGGTGAAATCCCTTTCAATTCCAATGGTGCTATTGTTGAGGCAAAACCTCTCGTAT
ATGAGTGTGGCCCATCATGCAGGTGCCCTCCAACATGCCACAACAGGGTGAGTCAGCATG
GTATCAAAATTCCGCTGGAAATATTCAAGACGGGGAACAAAGGTTGGGGTGTAAGATCTC
TGAGCTCTATCTCTTCAGGCAGTTTCGTATGTGAGTATGCAGGTGAGGTGCTGCAAGAAA
ATGGAGATGAACATGTAGAGACTGATGAGTACCTTTTTGATATTGGTCATCACTATCATG
ATGAAGTTTGGGAGGATCCTAAATTTGAAGGCATTTTGGGTCTAGAATCTTCTACGTCCA
AGACAACGGAGGATACTGAAGGCAGTAAAACAACGGAGGATACTGAAGGCAGTACTATCG
ATGCATCAAAGTGCAGCAATGTTGGAAGATTCATCAACCACAGCTGCTCGCCTAATCTGT
ATGCTCAAAATGTTCTCTGGGATCATGATGACATGAAGAAACCGCACATCATGTTCTTTG
CCACCGAGAACATACCGCCGCTGCAAGAGCTTACTTACGATTACAATTACGGTAAAGTCG
AGGATAAGAATGGCAAGGAGAAGGTTAAACCTTGCTTCTGTGGTTCGCCTGATTGCTCTC
GCAGGCTGTACTGAGATGCTGTTGGTTGATGATGATGATGGCGACAATGGTGCCCATTTT
TCAGTGGAACACTGTTCTGTCGTGCT

CDS

2766 bp

>Os09t0362900-01 SET domain containing protein.
ATGTCAGTTCTGAATCCTCCACCCAAAAGAAGGGCGATCTCAGCCATACGCAAATTTCCA
CGTGACTGTGGGAGGGCTGCTTCTACTCTTGCGGAAAGTGGTGCCTCTATGGAGGAGTTG
CCTTTAGAAGCAACACCTATTAGTGTAGCTACCGGTGGTGCCTCTATGGAGGATTCCTTG
GCGAGAACCCCTATTTCAGTCCAGGGTGCTTCTTTGGTGTGCGGTCTAGACCATTCTAGT
GAGGCAATAGATGGCAAGACAATTGAAGATGATGAATCTAGCAAGGTAGAAAATAGGATC
CAAGAGTTCCAAGTTGCCACAAATGTTGCCCTAGATGATTTTGAAGGAGCCAAGAATGGT
AGTACACACCCAAATGATTCTATTGCCAAACCTTCTCCTAGCCATGGTTTTGTTGAGAGG
GTGAATGGAAAGGGATCACAACAAGAAAAGAAGCTTGTAGCACGAAGTGCTGGGGATGGC
AAGATGGTAAGCAAATATGAAGAGAGATTACAAAAAGGTACTCCCGAGACTCGTATGAGA
GATCTTGTCGATGTAAAGGCAAAAAAGAAGATATTAAAGAGTGATAAGATGAATGGGGCA
TTGCAAAATGACGCTAGATCCTCTGGAGATGGTAAGATGAAAACGAAGGCTTCAAGCACT
CAGAGAGGTGTGGTGCGCTCGGATATGAGCTTGAAGCAAGGTGATATTGCTCGTAAGGTT
GATGCCACAGGCAAATGCAAGGGCGGCGTGAATAGCCTCATAAAGGAGGCTACATCTGGG
AAGCATGCTACGACTAATGGAATTGAAGAAAATGATGATAGAGACCTTGTCAGTGACAGG
ATAATTGTACAAGCACTAATGGCCCCAGACAAATGCCCGTGGACACGAAGAAGGAAGTCT
ATTGGTGGTTCCTCCGAGTCTCGTACTCCTAAGCTTAAGAAAAAGTTTGGTAGGCCAAGG
AAAGAATTGAAAGATACTACTCCAAGGGAAGAAGTTTCCCCGGAAGTTGCCTCTTGTAAA
GCGATCAAGCATGAGGCCATAGAGGACAAGGAGGATTCTTACTTTGAGGATGAAGGCAAC
TCTAAGGCTTCTTACTCGGATGTTGAAGGCAACTCTAAGGAGCTAGTGCGTGGAGGAAAG
GCACTAGTTGTTTGTGGAGGAAAGAAGGAGTTATGTGTTACACTCCCTCCTTCGGCTCCT
TTTGGCACAGATCCCCGAAGCAAAATAAGGAATTTACTCATAAAATTCCATGCGGCATGC
CGAAAGCTTGTGCAAGTTGAGGAACAACATAAAGGTAATATTGGAAGAATTGACATCGAG
GCTGGTAAAGCCCTAAAACAAAACGGTTTTATTAAGCCCGGACCTATTGTTGGCAATGTT
GCGGGAGTTGAAGTTGGAGATGAGTTTAATTTTAGAATCGAATTGTCATTTGTTGGACTC
CATCGCCCATATCAAGGAGGTATTGACAGTACAAAGGTGAATGGAATCCTCGTTGCTATA
AGTATTGTTGCTTCCGGAGGTTATCATGATGAATTGTCTAGCTCCGATGAACTCATATAT
ACGGGTTCTGGAGGAAAGGCCATCGGGAATAAGGCAGCTGGAGATCAAAAGCTTGAGCGT
GGTAATCTAGCTTTGAAGAATTCTATTGAAACTAAGACTCCGGTCCGAGTGATTCATGGA
TTCAAAGGTCATAGTAAAGGTGAAGCTAGCCATTCTAAATCCAAGCAAATCTCAACATAT
ATTTATGATGGGCTGTACATGGTGGTGGATTATTGGAAAGAAGGCCCAGAGGGCTCGATG
GTCTACAAGTACAAGTTGCAAAGGATCCCAGGTCAACCCGAGTTAGCATTACACATAATC
AAGGCAACGAGGAAGTCCAAAGTTCGCGAAGGTGTTTGTGTGCCTGATATATCTCAAGGA
AGGGAGAGGATTCCCATACCTGCGATCAACACAATTGACGATACGCAGCCAACAGCATTT
AAGTACACTACGGAAGTCATATATCCACATTCCTATGCAAAAGAACCTCTGAAAGGCTGT
GATTGCACGAATGGTTGCTCAGACTCTAATAGATGTGCCTGTGCAGTGAAGAATGGAGGT
GAAATCCCTTTCAATTCCAATGGTGCTATTGTTGAGGCAAAACCTCTCGTATATGAGTGT
GGCCCATCATGCAGGTGCCCTCCAACATGCCACAACAGGGTGAGTCAGCATGGTATCAAA
ATTCCGCTGGAAATATTCAAGACGGGGAACAAAGGTTGGGGTGTAAGATCTCTGAGCTCT
ATCTCTTCAGGCAGTTTCGTATGTGAGTATGCAGGTGAGGTGCTGCAAGAAAATGGAGAT
GAACATGTAGAGACTGATGAGTACCTTTTTGATATTGGTCATCACTATCATGATGAAGTT
TGGGAGGATCCTAAATTTGAAGGCATTTTGGGTCTAGAATCTTCTACGTCCAAGACAACG
GAGGATACTGAAGGCAGTAAAACAACGGAGGATACTGAAGGCAGTACTATCGATGCATCA
AAGTGCAGCAATGTTGGAAGATTCATCAACCACAGCTGCTCGCCTAATCTGTATGCTCAA
AATGTTCTCTGGGATCATGATGACATGAAGAAACCGCACATCATGTTCTTTGCCACCGAG
AACATACCGCCGCTGCAAGAGCTTACTTACGATTACAATTACGGTAAAGTCGAGGATAAG
AATGGCAAGGAGAAGGTTAAACCTTGCTTCTGTGGTTCGCCTGATTGCTCTCGCAGGCTG
TACTGA

Protein

922 aa

>Os09t0362900-01 SET domain containing protein.
MSVLNPPPKRRAISAIRKFPRDCGRAASTLAESGASMEELPLEATPISVATGGASMEDSL
ARTPISVQGASLVCGLDHSSEAIDGKTIEDDESSKVENRIQEFQVATNVALDDFEGAKNG
STHPNDSIAKPSPSHGFVERVNGKGSQQEKKLVARSAGDGKMVSKYEERLQKGTPETRMR
DLVDVKAKKKILKSDKMNGALQNDARSSGDGKMKTKASSTQRGVVRSDMSLKQGDIARKV
DATGKCKGGVNSLIKEATSGKHATTNGIEENDDRDLVSDRIIVQALMAPDKCPWTRRRKS
IGGSSESRTPKLKKKFGRPRKELKDTTPREEVSPEVASCKAIKHEAIEDKEDSYFEDEGN
SKASYSDVEGNSKELVRGGKALVVCGGKKELCVTLPPSAPFGTDPRSKIRNLLIKFHAAC
RKLVQVEEQHKGNIGRIDIEAGKALKQNGFIKPGPIVGNVAGVEVGDEFNFRIELSFVGL
HRPYQGGIDSTKVNGILVAISIVASGGYHDELSSSDELIYTGSGGKAIGNKAAGDQKLER
GNLALKNSIETKTPVRVIHGFKGHSKGEASHSKSKQISTYIYDGLYMVVDYWKEGPEGSM
VYKYKLQRIPGQPELALHIIKATRKSKVREGVCVPDISQGRERIPIPAINTIDDTQPTAF
KYTTEVIYPHSYAKEPLKGCDCTNGCSDSNRCACAVKNGGEIPFNSNGAIVEAKPLVYEC
GPSCRCPPTCHNRVSQHGIKIPLEIFKTGNKGWGVRSLSSISSGSFVCEYAGEVLQENGD
EHVETDEYLFDIGHHYHDEVWEDPKFEGILGLESSTSKTTEDTEGSKTTEDTEGSTIDAS
KCSNVGRFINHSCSPNLYAQNVLWDHDDMKKPHIMFFATENIPPLQELTYDYNYGKVEDK
NGKEKVKPCFCGSPDCSRRLY*

5'UTR

chr09:11870519..11870646 (+ strand) : 128 bp

CDS

chr09:11870647..11872820 (+ strand) : 2174 bp

chr09:11873588..11874179 (+ strand) : 592 bp

3'UTR

chr09:11874180..11874251 (+ strand) : 72 bp

FASTA

>Os09t0362900-01 class=Sequence position=chr09:11870519..11874251 (+ strand)
GCTGTGAATT CGAGAGAAAG GAAGTTACTA GCGATCGGGA TGGCCGAGAG ACGGAAAGTA GAGTAGGTGT TGGTCAATTA
GAGAGGACAA ATGATGTACA TGATGGTGGC AGAAAAAAGA GGTGGTTGAT GTCAGTTCTG AATCCTCCAC CCAAAAGAAG
GGCGATCTCA GCCATACGCA AATTTCCACG TGACTGTGGG AGGGCTGCTT CTACTCTTGC GGAAAGTGGT GCCTCTATGG
AGGAGTTGCC TTTAGAAGCA ACACCTATTA GTGTAGCTAC CGGTGGTGCC TCTATGGAGG ATTCCTTGGC GAGAACCCCT
ATTTCAGTCC AGGGTGCTTC TTTGGTGTGC GGTCTAGACC ATTCTAGTGA GGCAATAGAT GGCAAGACAA TTGAAGATGA
TGAATCTAGC AAGGTAGAAA ATAGGATCCA AGAGTTCCAA GTTGCCACAA ATGTTGCCCT AGATGATTTT GAAGGAGCCA
AGAATGGTAG TACACACCCA AATGATTCTA TTGCCAAACC TTCTCCTAGC CATGGTTTTG TTGAGAGGGT GAATGGAAAG
GGATCACAAC AAGAAAAGAA GCTTGTAGCA CGAAGTGCTG GGGATGGCAA GATGGTAAGC AAATATGAAG AGAGATTACA
AAAAGGTACT CCCGAGACTC GTATGAGAGA TCTTGTCGAT GTAAAGGCAA AAAAGAAGAT ATTAAAGAGT GATAAGATGA
ATGGGGCATT GCAAAATGAC GCTAGATCCT CTGGAGATGG TAAGATGAAA ACGAAGGCTT CAAGCACTCA GAGAGGTGTG
GTGCGCTCGG ATATGAGCTT GAAGCAAGGT GATATTGCTC GTAAGGTTGA TGCCACAGGC AAATGCAAGG GCGGCGTGAA
TAGCCTCATA AAGGAGGCTA CATCTGGGAA GCATGCTACG ACTAATGGAA TTGAAGAAAA TGATGATAGA GACCTTGTCA
GTGACAGGAT AATTGTACAA GCACTAATGG CCCCAGACAA ATGCCCGTGG ACACGAAGAA GGAAGTCTAT TGGTGGTTCC
TCCGAGTCTC GTACTCCTAA GCTTAAGAAA AAGTTTGGTA GGCCAAGGAA AGAATTGAAA GATACTACTC CAAGGGAAGA
AGTTTCCCCG GAAGTTGCCT CTTGTAAAGC GATCAAGCAT GAGGCCATAG AGGACAAGGA GGATTCTTAC TTTGAGGATG
AAGGCAACTC TAAGGCTTCT TACTCGGATG TTGAAGGCAA CTCTAAGGAG CTAGTGCGTG GAGGAAAGGC ACTAGTTGTT
TGTGGAGGAA AGAAGGAGTT ATGTGTTACA CTCCCTCCTT CGGCTCCTTT TGGCACAGAT CCCCGAAGCA AAATAAGGAA
TTTACTCATA AAATTCCATG CGGCATGCCG AAAGCTTGTG CAAGTTGAGG AACAACATAA AGGTAATATT GGAAGAATTG
ACATCGAGGC TGGTAAAGCC CTAAAACAAA ACGGTTTTAT TAAGCCCGGA CCTATTGTTG GCAATGTTGC GGGAGTTGAA
GTTGGAGATG AGTTTAATTT TAGAATCGAA TTGTCATTTG TTGGACTCCA TCGCCCATAT CAAGGAGGTA TTGACAGTAC
AAAGGTGAAT GGAATCCTCG TTGCTATAAG TATTGTTGCT TCCGGAGGTT ATCATGATGA ATTGTCTAGC TCCGATGAAC
TCATATATAC GGGTTCTGGA GGAAAGGCCA TCGGGAATAA GGCAGCTGGA GATCAAAAGC TTGAGCGTGG TAATCTAGCT
TTGAAGAATT CTATTGAAAC TAAGACTCCG GTCCGAGTGA TTCATGGATT CAAAGGTCAT AGTAAAGGTG AAGCTAGCCA
TTCTAAATCC AAGCAAATCT CAACATATAT TTATGATGGG CTGTACATGG TGGTGGATTA TTGGAAAGAA GGCCCAGAGG
GCTCGATGGT CTACAAGTAC AAGTTGCAAA GGATCCCAGG TCAACCCGAG TTAGCATTAC ACATAATCAA GGCAACGAGG
AAGTCCAAAG TTCGCGAAGG TGTTTGTGTG CCTGATATAT CTCAAGGAAG GGAGAGGATT CCCATACCTG CGATCAACAC
AATTGACGAT ACGCAGCCAA CAGCATTTAA GTACACTACG GAAGTCATAT ATCCACATTC CTATGCAAAA GAACCTCTGA
AAGGCTGTGA TTGCACGAAT GGTTGCTCAG ACTCTAATAG ATGTGCCTGT GCAGTGAAGA ATGGAGGTGA AATCCCTTTC
AATTCCAATG GTGCTATTGT TGAGGCAAAA CCTCTCGTAT ATGAGTGTGG CCCATCATGC AGGTATGACG TGCAAAAGCT
TAGCAATCCA AAATAATAAC AATAACTAAA TAGGAGTAAC ATTTGCATCA TATTCTGATA ATACCAAAGT AGATTCACAG
AACCAGGAAA TATTTCTCAT TGCTTCTGAA ATTTTTACCC TTTCAACAAG GGCTGACATT TGGTTGCAGA TTCATTTGTC
AGTGAAACAC CCTGCAACAC ACAAGGAACA TAAAATTGTT GGTGGCATAG TTTAAAATTT CTCATAAAAC CAACCATTTT
CACCTTAAGT CTGTAGGTTT TCACACCAGA ACTATTCATT TACAGCAGAT CATTAGGTTG AAGGGAATAA TAAAATATAT
TCTCAATCAG AGAGCTAGAC ATATTATCAT AACAGCGAAA TTGGTTCATT CACCTTAAAT TGGTAGGTTT GCATATCAGA
ACTACTCATT CACATTGCAC AATTAGGTTA ATTTGAAACT ACAAGTTCTG TTCCGATGCT TTGAGCTAAC TAATGCTAAT
ATGCATTGTT TGCCTGAAGT TAATTGTTTT TCGCGCCAGA ATTATTATTA GATTAAACCC AAATTGTAAA TTCTGTTTGA
AAGCTGTGAA ATACCAAATG CTCAAACCAA CATATTGATT ACAGAAGCAA CCAATTCACG TCAAGTTAAT TAGTTTTTAC
AATAGAATTT ATTTGTTTGT ATTGGAATAT CAAGTTAAAC CGGAAGTAGA AGTTCTGTTC TAAAGCAGGG AGCTAATCTA
GCTAATCTAA TGTTCAAAAC TATGTGCAGG TGCCCTCCAA CATGCCACAA CAGGGTGAGT CAGCATGGTA TCAAAATTCC
GCTGGAAATA TTCAAGACGG GGAACAAAGG TTGGGGTGTA AGATCTCTGA GCTCTATCTC TTCAGGCAGT TTCGTATGTG
AGTATGCAGG TGAGGTGCTG CAAGAAAATG GAGATGAACA TGTAGAGACT GATGAGTACC TTTTTGATAT TGGTCATCAC
TATCATGATG AAGTTTGGGA GGATCCTAAA TTTGAAGGCA TTTTGGGTCT AGAATCTTCT ACGTCCAAGA CAACGGAGGA
TACTGAAGGC AGTAAAACAA CGGAGGATAC TGAAGGCAGT ACTATCGATG CATCAAAGTG CAGCAATGTT GGAAGATTCA
TCAACCACAG CTGCTCGCCT AATCTGTATG CTCAAAATGT TCTCTGGGAT CATGATGACA TGAAGAAACC GCACATCATG
TTCTTTGCCA CCGAGAACAT ACCGCCGCTG CAAGAGCTTA CTTACGATTA CAATTACGGT AAAGTCGAGG ATAAGAATGG
CAAGGAGAAG GTTAAACCTT GCTTCTGTGG TTCGCCTGAT TGCTCTCGCA GGCTGTACTG AGATGCTGTT GGTTGATGAT
GATGATGGCG ACAATGGTGC CCATTTTTCA GTGGAACACT GTTCTGTCGT GCT

Locus: Os09g0362900

Loading...

Locus: Os09g0362900

Loading...