Os09t0368200-00

Locus

Os09g0368200

Description

Similar to polyamine oxidase precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PAOB

CGSNL Gene Name

POLYAMINE OXIDASE B

Oryzabase Gene Symbol Synonym(s)

PAOb, OsPAOb, OsPAO6, OsPAO2, PAO6, PAO2

Oryzabase Gene Name Synonym(s)

Polyamine oxidase b, Polyamine oxidase 6

Transcript Evidence

AK367335 (DDBJ)

Protein Evidence

NP_001105106.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Flavin amine oxidase (IPR001613)

Amine oxidase (IPR002937)

Expression Databases

TENOR (Os09t0368200-00)

Others

Oryzabase (11223)

Transcript

1548 bp

>Os09t0368200-00 Similar to polyamine oxidase precursor.
TAGGTACAAGTTCATTCTCGTGCCAAGAAGGGAGATCGAGAGTACTTGAAAGACAGTATG
ACGAAGCCCACGACGATGGCCATTTTTCTTGTCTTAGCGCTATCCATAGCACAGCTTCTT
CCGTCCCTCGTCGCTGGCACCGGCCGGCCAAGGGTCATCATTGTTGGCGCTGGCATATCC
GGTATCTCAGCGGGGAAGCGGATATGGGAGGCTGGGATAGCAGACGTATTGATCTTAGAG
GCGACAGACCGCATTGGCGGGCGGATGCACAAGCAGAGTTTCGCCGGCGTCAATGTGGAG
ATCGGTGCCAACTGGGTGGAGGGCGTCAATGGCGAAAAGAAGAACCCCATTTGGCCCATC
GTCAACTCCACCCTCAAGCTCAGAAGCTTCCGCTCCGACTTTGACAGCCTTGCCCAGAAC
GTCTACAAGGACGGAGGCCTCTGTGACGAAGCATACGTGCAGAAGAGAATGGATCGGGCA
GATGAAGTGGACAAGAGTGGGGAGAATCTCTCCGCCACACTGCACCCAAGCGGCCGGGAC
GACATGTCAATCCTTTCAATGCAACGGCTCAACGATCACCTACCCAACGGCCCGTCGTCG
CCGGTGGACATGGCGGTGGACTACTTCACCTACGACTACGAGTTCGCCGAGCCGCCGCGC
GTGACCAGCCTGCAGAACACCGTTCCCCTCCCCACCTTCACCGACTTCGGAGACGACACC
TACTTCGTCGCCGACCAACGTGGCTACGAGTCCGTCGTCCACCACCTCGCCGGCCAGTAC
CTCAACGCCGACAAGTCCGGCAACATCGCCGACGCCCGCCTGAAGCTCAACAAGGTGGTG
CGTGAGATCTCCTACTCCTCGACCGGCGTCACCGTGAAGACGGAGGACAACTCGACGTAC
CAGGCAGACTATGTCATGGTTTCTGCGAGCTTGGGAGTCCTGCAGAGCGATCTCATACAG
TTCAAGCCACAGCTGCCTTCTTGGAAGATTCTTGCGATCTACCAATTCGACATGGCCGTG
TACACCAAGATATTCGTCAAGTTCCCCAAGAAATTCTGGCCCGAAGGGGCAGGGAGGGAG
TTCTTCCTCTACGCGAGCACCAGGAGAGGCTACTACGGAGTCTGGCAGGAGTTTGAGAAG
CAATACCCGGATGCCAATGTGCTCCTGGTGACGGTGACCGACGAGGAGTCGAGGCGGATC
GAGCAGCAGCCGGACAGCCAGACCAAGGCAGAGATCATGGAGGTTGTGAGGTGCATGTTC
CCTGACGAGGATGTCCCCGACGCCACCGACATCCTCGTCCCGAGATGGTGGTCCGACAGG
TTCTTCCGGGGCAGCTTCTCCAACTGGCCCATCGGCGTCAGTCGCTACGAGTATGACCAG
CTCAGGGCGCCGGTTGGGAGAGTGTACTTCACCGGTGAGCACACGAGCGAGCGCTACAAT
GGCTATGTCCATGGAGCTTATCTTGCAGGTATTGACTCTGCAGAGATTCTGATCAACTGT
GCACAGAAGAAGATGTGCAAATATAATGTCGGGGGCAAGCACGGCTAG

CDS

1491 bp

>Os09t0368200-00 Similar to polyamine oxidase precursor.
ATGACGAAGCCCACGACGATGGCCATTTTTCTTGTCTTAGCGCTATCCATAGCACAGCTT
CTTCCGTCCCTCGTCGCTGGCACCGGCCGGCCAAGGGTCATCATTGTTGGCGCTGGCATA
TCCGGTATCTCAGCGGGGAAGCGGATATGGGAGGCTGGGATAGCAGACGTATTGATCTTA
GAGGCGACAGACCGCATTGGCGGGCGGATGCACAAGCAGAGTTTCGCCGGCGTCAATGTG
GAGATCGGTGCCAACTGGGTGGAGGGCGTCAATGGCGAAAAGAAGAACCCCATTTGGCCC
ATCGTCAACTCCACCCTCAAGCTCAGAAGCTTCCGCTCCGACTTTGACAGCCTTGCCCAG
AACGTCTACAAGGACGGAGGCCTCTGTGACGAAGCATACGTGCAGAAGAGAATGGATCGG
GCAGATGAAGTGGACAAGAGTGGGGAGAATCTCTCCGCCACACTGCACCCAAGCGGCCGG
GACGACATGTCAATCCTTTCAATGCAACGGCTCAACGATCACCTACCCAACGGCCCGTCG
TCGCCGGTGGACATGGCGGTGGACTACTTCACCTACGACTACGAGTTCGCCGAGCCGCCG
CGCGTGACCAGCCTGCAGAACACCGTTCCCCTCCCCACCTTCACCGACTTCGGAGACGAC
ACCTACTTCGTCGCCGACCAACGTGGCTACGAGTCCGTCGTCCACCACCTCGCCGGCCAG
TACCTCAACGCCGACAAGTCCGGCAACATCGCCGACGCCCGCCTGAAGCTCAACAAGGTG
GTGCGTGAGATCTCCTACTCCTCGACCGGCGTCACCGTGAAGACGGAGGACAACTCGACG
TACCAGGCAGACTATGTCATGGTTTCTGCGAGCTTGGGAGTCCTGCAGAGCGATCTCATA
CAGTTCAAGCCACAGCTGCCTTCTTGGAAGATTCTTGCGATCTACCAATTCGACATGGCC
GTGTACACCAAGATATTCGTCAAGTTCCCCAAGAAATTCTGGCCCGAAGGGGCAGGGAGG
GAGTTCTTCCTCTACGCGAGCACCAGGAGAGGCTACTACGGAGTCTGGCAGGAGTTTGAG
AAGCAATACCCGGATGCCAATGTGCTCCTGGTGACGGTGACCGACGAGGAGTCGAGGCGG
ATCGAGCAGCAGCCGGACAGCCAGACCAAGGCAGAGATCATGGAGGTTGTGAGGTGCATG
TTCCCTGACGAGGATGTCCCCGACGCCACCGACATCCTCGTCCCGAGATGGTGGTCCGAC
AGGTTCTTCCGGGGCAGCTTCTCCAACTGGCCCATCGGCGTCAGTCGCTACGAGTATGAC
CAGCTCAGGGCGCCGGTTGGGAGAGTGTACTTCACCGGTGAGCACACGAGCGAGCGCTAC
AATGGCTATGTCCATGGAGCTTATCTTGCAGGTATTGACTCTGCAGAGATTCTGATCAAC
TGTGCACAGAAGAAGATGTGCAAATATAATGTCGGGGGCAAGCACGGCTAG

Protein

497 aa

>Os09t0368200-00 Similar to polyamine oxidase precursor.
MTKPTTMAIFLVLALSIAQLLPSLVAGTGRPRVIIVGAGISGISAGKRIWEAGIADVLIL
EATDRIGGRMHKQSFAGVNVEIGANWVEGVNGEKKNPIWPIVNSTLKLRSFRSDFDSLAQ
NVYKDGGLCDEAYVQKRMDRADEVDKSGENLSATLHPSGRDDMSILSMQRLNDHLPNGPS
SPVDMAVDYFTYDYEFAEPPRVTSLQNTVPLPTFTDFGDDTYFVADQRGYESVVHHLAGQ
YLNADKSGNIADARLKLNKVVREISYSSTGVTVKTEDNSTYQADYVMVSASLGVLQSDLI
QFKPQLPSWKILAIYQFDMAVYTKIFVKFPKKFWPEGAGREFFLYASTRRGYYGVWQEFE
KQYPDANVLLVTVTDEESRRIEQQPDSQTKAEIMEVVRCMFPDEDVPDATDILVPRWWSD
RFFRGSFSNWPIGVSRYEYDQLRAPVGRVYFTGEHTSERYNGYVHGAYLAGIDSAEILIN
CAQKKMCKYNVGGKHG*

5'UTR

chr09:12154386..12154442 (- strand) : 57 bp

CDS

chr09:12154262..12154385 (- strand) : 124 bp

chr09:12151197..12151446 (- strand) : 250 bp

chr09:12148390..12148536 (- strand) : 147 bp

chr09:12147573..12147828 (- strand) : 256 bp

chr09:12147332..12147475 (- strand) : 144 bp

chr09:12147065..12147214 (- strand) : 150 bp

chr09:12146730..12146987 (- strand) : 258 bp

chr09:12146539..12146620 (- strand) : 82 bp

chr09:12146317..12146396 (- strand) : 80 bp

FASTA

>Os09t0368200-00 class=Sequence position=chr09:12146317..12154442 (- strand)
TAGGTACAAG TTCATTCTCG TGCCAAGAAG GGAGATCGAG AGTACTTGAA AGACAGTATG ACGAAGCCCA CGACGATGGC
CATTTTTCTT GTCTTAGCGC TATCCATAGC ACAGCTTCTT CCGTCCCTCG TCGCTGGCAC CGGCCGGCCA AGGGTCATCA
TTGTTGGCGC TGGCATATCC GGTACGTACA ATCTATctat tatattatta tagcactaga aaaaagagcc ttcacgttcg
ctctgatggc ctaaaaattt ttacattaat cggagaaaaa gaaaaggcag agtccatata gaaatacatt tagaaatagc
tgaaattcgg aattaaaaaa taaggaatat tagaagagga gactagagtc catatagaaa tacaatttag aaatagttga
aattcggaat taaaaaataa ggaatattag aagaggagac tagactccat atagaaatac aattaggaaa taactgaaag
tcggaattaa aaataaggaa tattagaaat agagtataga gtacttatag aaatacaatt agaaaatagc taaaattcga
aattaaaaat aaggattatt agaagaggag actagagtcc atatagaaat acaattagga aatagctgaa attcggaatt
aaaaaataag gaatattaaa agaggagact atagtccata tagaaataca attaggaaat aactgaaatt cgaaattaaa
aaataaggaa tattagaagt agagtataga gtccatatag aaatacaatt aggaaataat agaaattcgg aattaaaaat
ggggaatatt agaagtAGAG TATAGAGTCC ATATAGAAAT ACAATTAAAA AAAATAGAAA TTCGGAATTA AAAAAAAGGA
ATATTAGAAG TAGAATATAG AGTCCATAGG AATTTAAAAC TAACTAAAAT TCAGAATAAA AAGGAGCCTC CATGTTCGCT
CTCATGATCT AGAAATTGTC ACATTAATTG GAGAAAAAGA AAAAAGCaga gtctatatag aaatacaatt tagaaatagc
tgaaattcgg aattaaaaaa taaggaacat tagaagagga gactagactc catatataaa tacaatttag aaatagttga
aattcggaat taaaaaataa ttaatattag aagaggagac tagagtccat atagaaatat aattaggaaa taacagaaat
ttagaattaa aaataaggaa tattagaagt agagtataga gttcatatat aaatacaatt agtaaataat agaaattcgg
aattaaaaat aaggaatatt agaagtagag tatagagtcc atatagaaat acaattaaga aaaaaaagaa aattggaatt
aaaaaataag gaatattaga agtagattat agagtccata taggaatttg aaactaacta aaattcggaa taaacatGAT
AAAATTaaaa gtagagttta gagtccgtat aaaaatacaa tttacaaata actaaaattc gaaattaaga aaaacatggg
aagaagattt taaagtcaat ataggaatac aatttagaag taactgaaat ttgaaattaa aaattaaaga atattgaaag
atgagtttag agtccacata gaaatacaat tagaaataat aaaaattcag aattaaaaaa ataaatatta aaagacgagt
ctagagtcca tataggaata tatataattt ataaataact aaaatttgat atcaaaaata attaataact aacatgtata
taaaatacaa tatgaatatt acacattagt agtttcgtaa agttattgta aaatttaaaa ttatgttgtc attgtaatat
attttaataa tataatgaga aaacatatat gctattatat gagagaaaat ataatgatgc tagccgcgca atctgcgcgg
gccacCATGC TAGTTACTTT TACAGTGGTA TCTACCATCA CTCGTAGTAT TCCCtactcc ctccatccaa aaataaacca
acctcgtagt agggtataac gcatcctata tgttcagatt tattgtatcc tatatattaa gatttgttgt attaggatat
gtcgcattct aggttgtctt attttacgac agagagagta TAACAGTTGC CGGATGAAAA TCCCTCGTAG GTGTCGGATT
CCCAACCAGC ATTAATTTGG AGGCGCCTTT GCCCGTTCGC ATAGGTGCCA GTTATAAAAT CAACACTTAT AGAGATTATA
GGTGTCAATT CTATAGACAG ACCCGACACC TATAATCTTT GGAAAAAAGG GTTGTGGAGG CGCAAGGGAT CACCGACCTG
GTAGCAAAGG GCGACAAAGC TCCTTGTAGA AGTGCTTGAA GTGTCCTAGC AACTCGTCGA CAGCGGGGAA AGATAGGCGG
TGGGCCCCGG GCGTGCAGTC CCTGTGGAAC TTCAATAGGT GCTCATCCAC CAGGGTTCCG AGCGTTGAAC GAGGAGTCCC
CCTGTGCATG AGCACGCATG TGCACACACA ATGACACGAC CACACCTTAG ACACCACCGG ACCAAATCGT TGGAGGGAGG
AAGGGGAGGG GGGAGTGGAC ATTAtacttg tcagcttttt aattaattaa cgcctatgat atattatatg tgtcattcgt
tttttcaaaa TCGGTACTTA TAGAATTAAT GCCAGCTTTT CCTATAGCTG CTTAAAGGTG CATAGGTGTT GGTTTTAAAC
GAACCAACAC TTATGAGCTG ATATCTATTA GGGATTCTAC AGTAGTAACT CCAATATTAT TACTATGTTA GCCACAATGC
TATGTTTTTA ATTATGATGT ATGTTACATG TTAGTTTATA CGGACCCATA GTACAAATTA TGGTTCACAC ATTAGAGATA
AATTGGTCCG GTGGTAGATA CCATATATAG GAGTAGTACA TATCATGAGT TAAAATCTCG GTCTCCACAA GCTGAGAACC
GCATGTACAT TGATTTACAT CTATATTGCT GTGCAGGTAT CTCAGCGGGG AAGCGGATAT GGGAGGCTGG GATAGCAGAC
GTATTGATCT TAGAGGCGAC AGACCGCATT GGCGGGCGGA TGCACAAGCA GAGTTTCGCC GGCGTCAATG TGGAGATCGG
TGCCAACTGG GTGGAGGGCG TCAATGGCGA AAAGAAGAAC CCCATTTGGC CCATCGTCAA CTCCACCCTC AAGCTCAGAA
GCTTCCGCTC CGACTTTGAC AGCCTTGCCC AGAACGTCTA CAAGGAGTAC GTACATTTTC ACACAACCAC AAGTTGGTGG
ATAAATTGGA GCAGCTAACA ACTTGACACG TGATTAATCA GACATATTTC TCTAATGACA TGTTTTAATT GCATATGTTG
ATGTGTGCGA ATCATAGTAC AATAATTAAC ACACTCATCA TCAGTTGTCA ATTCCAAACC GTCACCACTG TTGGTTAATT
ATTGCATGCA CAGCACAGCA CTCAGAACTG TATCATTTAG TATTCATGCA CCATTCACTT ATCAACAAGA GTAACTAATA
ATTGGATACT TTGTGCGGCC CACGAAATGG AATAATTATA CTTAATTTGA AAAAGTTGAT GAAATTTCAA CAAGAGATCA
AAAATTTCAA AATGCAAAGC TTTTTTTTAG ATTAAAACAT TCATATAAAT ATTGGAGAAA TTTCACACAA TTTTCAGGTA
ATTAAAACAT TCATACACAA TGTTCAAGCA CAAAACATTC AAATATAGAT CAAGAGATAT ATATAAGTGA CTTTTCTCCC
AACTTTTGGT TTTACCTTGA AACTATCTAC CGTGTAAACA TGGAATAGTA CTTGGAAGAA AACTAGGTAT TGTTGGTCAA
ACTTTTTCTC TTTCCCGGCC ACTAGCTATC AGTTCCCCAT TTCTTGAGTT TTTTTATTTC TTTTGTGCGA GGAGTTCCTT
AGTAGTAAAC TATAGATAGT ATGGGTTCTC ATTGGAAGAT AGATAGGTAA ACATGAGAGG GTAAACTTAT AAATACTACC
TTTGTCTTAG AACCCGTTCT AAGCAGATAC ATCAAACGGC TAAttagccg cacatgagaa atgtgattag catataatta
attgtattaa ttattaaaaa ctttttgatt tttaatagct tgtatataaa agaaattttg taggtaagac atcgtttagc
aatttaaaaa catactaacg gaaaatgaga aatagctaag ttgaattagc acttcagaat aagGTCTTAA AATTAGTAGC
TAGAAATAAA AAAAAATTAG GACGAAGGGA GTAGATAAAT ACTAAACCTT CTAAACCACT TAAGGGCAAT CCCAACACTC
AAagggaaaa atatgaagaa actattattt cttatacaag acactagctt taaaggaaca aaaataagga taaaaagaaa
gagaagggag atgatttgat gagagtttat tttaaataaa tcgtctatat tgggtatata gtttctgcgt acattgtcga
tataacatgg tatatatgaa aactagtaat agtttttggg ttAAGATTGT TCTAATGATC AACCTTCTAT TTATTTCACG
CTGAATGCCA CCTCACAGTT GTACGTTCGT AGGCAAGTGG CCAACAAGAT AACAGTGCCC GGCCCCATCA TGCTTATGGG
AAACCAATCG CAATAGCATA CAAGTTGTAT CAAATTGGCC ATAGGTAATG TTTACATGTG CACATGGCTT TATGAGAAAA
GATGGACAAT TTGCACCATG CATAAGTGAT CGAAAGGTTA GAAATAGTTA TGGTAACGTT ACTTCTCATC AGAAGAGAAA
ATTGGCATTA AAAATATTTA GTGGGGATTC AATTTTATGg atgacgttct ctttcgtggt ccaatcttct ggtgagggga
taactctcgg tttgatcgag tgcgacattt gcgatatggc taccaaccag aacaaggaca tgacgttgtg caatcgctac
accacaaaca atgtcatacc aaccgtgaca cacggttgat gatctttaca atgcaaacga gagaacattg caagaacaag
atataagatg caatctaaat attgcgaata ggtaattaag cacaaattaa tagttgtgat taaagtgata tatctaatcg
atccgataaa tcaacacacc aactattagg ggctctgaat ctattgtcgc cgactaatta atcgagcgag gactatagac
aaggtgaatg gcacttggca aaatccaact aaaccaaaac acaattgttc tagagggtat acatatacat ttatagagga
aaatggatct agagttaagt gctaattcat ggaggtggag ggagacactt ttgagatggg actagccatg tcttgtttta
aagattcttg ttgactcgga atgaatttgg atgagaccgg atgcgtttga aagatagcga gataatcttt ccatcaagtc
caggatcacc taaatcggag ttggcatgga gacgctacgt ccgtttgaag taagtactat ctccggaggc tgaactgaac
ttggacttga aattatcatt agaacgtgtg aagttacgtg cgtatccgat gaagtaatgc cctcatcGTT TATTGGAACA
AATACATAAT GTCAACATAA CAAACATAAT ATAAATTGAA ATTTTGATCT TTCGGAAAAA ACAAACGTAT AAATTCTCGA
CAAATTAACG CATATGGATA CTGCAAGTTT CTACCTGGGT CCAGGAACTT ATATTTGTTC AAACCGATAA ATGTTTGTGA
CATGAGTAGA TTCTACACCG AACTTAATTA TTTTTTTAAA AAAAATAATG GAAACTTAAT TAATTAGTAT CATGTATATT
TTTTTCCTCC AATATATATA TGCTACCATA CATATATGCA TGTTGCCTGA TGTTGTATAA CTTCAGCGGA GGCCTCTGTG
ACGAAGCATA CGTGCAGAAG AGAATGGATC GGGCAGATGA AGTGGACAAG AGTGGGGAGA ATCTCTCCGC CACACTGCAC
CCAAGCGGCC GGGACGACAT GTCAATCCTT TCAATGCAAC GGCTCAACGA TCAGTACGTG CCTCTGCCCC TCAAGTCTTT
ACTTGAAAAA AAAAACGTTA AGCACATAAA AGAACACTTC AAAAGTTATT TGATTTTTTT TGCGACAAAA AGTTATTCGA
ATTGATTTGT CTTACTGTAA GAGTATAGAT AGATATAGAA AATCGTTTGA AATTTGTGTA AGGACTGAAC TAATCGTATA
TTGGGCCTCG AAAGATGTAG GACTATCAAC TAGGCCCAAA AAGACACTAA GGCCTCcttc aagatttata gttggaattt
tgatagatca atgaacaagt tgattttgtg atagctattt gagggtatat acacaaatta attaattaac tactacttac
aaatttaaaa agttggttca gcaaaacagt atatagaaaa ctttacacaa aatatccatt tagaagctta gaaaacgcgc
aaatgaaaaa tccaaaatCC AGTACAAGCT AGCTGGCCTG AATAACTGGC CTGACAAGCA GTACAACATA GCACTACAAG
CTGTGAATTT ACTTTCTGCT GTTTCGGGTG CGTGCAAATG CATGCAATTG GCAGCCTACC CAACGGCCCG TCGTCGCCGG
TGGACATGGC GGTGGACTAC TTCACCTACG ACTACGAGTT CGCCGAGCCG CCGCGCGTGA CCAGCCTGCA GAACACCGTT
CCCCTCCCCA CCTTCACCGA CTTCGGAGAC GACACCTACT TCGTCGCCGA CCAACGTGGC TACGAGTCCG TCGTCCACCA
CCTCGCCGGC CAGTACCTCA ACGCCGACAA GTCCGGCAAC ATCGCCGACG CCCGCCTGAA GCTCAACAAG GTTGATCATA
TCACTTCTGA TGCCATGATC TTTTCTGTCA GAAAAGATGA ACTGATTAAG CACGCGATCA TCATGGTGGT ATATATGATC
GATGCAGGTG GTGCGTGAGA TCTCCTACTC CTCGACCGGC GTCACCGTGA AGACGGAGGA CAACTCGACG TACCAGGCAG
ACTATGTCAT GGTTTCTGCG AGCTTGGGAG TCCTGCAGAG CGATCTCATA CAGTTCAAGC CACAGCTGCC TGTCAGTTTC
TATGTCCAAA TGTCCTTGCA TGTTCAACAT ATCCTCTTCC AAATATAAAT TAAGATGTGC ATATCGAGCA GTCAAATTTA
CTTTACGTTT CTTGCATGTT TCCATCAGTC TTGGAAGATT CTTGCGATCT ACCAATTCGA CATGGCCGTG TACACCAAGA
TATTCGTCAA GTTCCCCAAG AAATTCTGGC CCGAAGGGGC AGGGAGGGAG TTCTTCCTCT ACGCGAGCAC CAGGAGAGGC
TACTACGGAG TCTGGCAGGT ACAAAATATG CAGCAATATA TACAATCCAC TCACATCGAA TTGTAGTACA TTGCGATGAT
CTGAACATTC TTCAGGAGTT TGAGAAGCAA TACCCGGATG CCAATGTGCT CCTGGTGACG GTGACCGACG AGGAGTCGAG
GCGGATCGAG CAGCAGCCGG ACAGCCAGAC CAAGGCAGAG ATCATGGAGG TTGTGAGGTG CATGTTCCCT GACGAGGATG
TCCCCGACGC CACCGACATC CTCGTCCCGA GATGGTGGTC CGACAGGTTC TTCCGGGGCA GCTTCTCCAA CTGGCCCATC
GGCGTCAGTC GCTACGAGTA TGACCAGCTC AGGGTACGAA CTACTACTCC AACCAAATGC TAATCACAAT TCACAAATTG
ATGCGGTTTG GATTTGAGAT TAATTTTGGT TGTGTGTATT TTTTGCTGTT TCTGTGCACA AGGCGCCGGT TGGGAGAGTG
TACTTCACCG GTGAGCACAC GAGCGAGCGC TACAATGGCT ATGTCCATGG AGCTTATCTT GCAGGTATCC ATATGTCAGA
TAGGCCGGAC ATTTAAACCA TTTTTATTGT TCTAAAAGAG AACTACCCTA GGGTAGGGAT CGACGAGATT TGTAATGCTA
ACATTTGTGC TCAAGTGTGC GTTGTGCCTT TGCTTGTTTT TGTCAGGTAT TGACTCTGCA GAGATTCTGA TCAACTGTGC
ACAGAAGAAG ATGTGCAAAT ATAATGTCGG GGGCAAGCAC GGCTAG

Locus: Os09g0368200

Loading...

Locus: Os09g0368200

Loading...