Os09t0368500-01

Locus

Os09g0368500

Description

Terminal catabolism-type polyamine oxidase, Anther development

RAP-DB Gene Symbol Synonym(s)

PAO7, OsPAO7, OsPAO3

RAP-DB Gene Name Synonym(s)

POLYAMINE OXIDASE 7, Polyamine oxidase 7

CGSNL Gene Symbol

PAO7

CGSNL Gene Name

POLYAMINE OXIDASE 7

Oryzabase Gene Symbol Synonym(s)

OsPAO7, OsPAO3, PAO3

Oryzabase Gene Name Synonym(s)

Polyamine oxidase 7

Transcript Evidence

AK069392

Protein Evidence

Q0J290

Literature

PMID: 24634478

Note

Manual Curation

November 19, 2014

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Flavin amine oxidase (IPR001613)

NAD(P)-binding domain (IPR016040)

Amine oxidase (IPR002937)

Full-length cDNA

J023014L10 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0368500-01)

Others

Oryzabase (11407)

KEGG (Os09t0368500-01 (EC:1.5.3.11))

Transcript

1584 bp

>Os09t0368500-01 Terminal catabolism-type polyamine oxidase, Anther development
TGGAAGAGAGTATGACGAAGCCCACGACGATGGCCATTTTTCTTTCTATAGTGCTACTAT
CCATGGCACAGCTTCCCTCTCTCGTCGCCGGCACCGGCCGGCCAAGGGTCATAATCATCG
GCGCCGGCATATCCGGTATTTCAGCGGGGAAGCGGCTGTCGGAGGCTGGGATAACGGACA
TATTGATCTTAGAGGCAACAGACCACATTGGCGGGCGGATGCACAAACAGAGGTTTGCCG
GCGTCAATGTGGAGATCGGCGCCAATTGGGTGGAGGGCGTCAATGGTGAGAAGATGAACC
CCATTTGGCCCATCGTCAACTCCACCCTCAAGCTTAGGAACTTCCTCTCCGACTTCGACA
GTCTTGCCCAAAACGTCTACAAGGACGGTGGCCTCTGCGACGCAGCATACGTGCAGAAGA
GAATCGACCTGGCTGATGAAGCGGATAAGAGTGGGGAGAATCTCTCCGCCACACTGCACC
CAAGCGGCCGGGACGACATGTCAATCCTTTCAATGCAACGGCTCAACAATCACCTGCCCA
ACGGCCCGTCGTCGCCGGTGGACATGGTGGTGGACTACTTCACCTACGACTACGAGTTCG
CCGAGCCGCCGCGCGTGACCAGCCTGCGGAACACCGTTCCCCTCCCGACCTTCACCGACT
TCGGAGACGACAACTACTTCGTCGCCGACCAACGGGGCTACGAGGCCGTCGTCTACTACC
TCGCCGGCCAATACCTCGAAGCCGACAAGTCCGGCAACATCGTTGACGCTCGCCTGCAGC
TCAACAAGGTGGTGCGTGAGATCTCCTACTCCTCGACCGGCGTCACCGTGAAGACGGAGG
ACAACTCGACGTACCAGGCAGACTATGTCATGGTTTCTGCGAGCTTGGGAGTCCTGCAGA
GCGATCTCATACAGTTCAAGCCACAGCTGCCTTCTTGGAAGATTCTTGCGATCTACCAAT
TCGACATGGCCGTGTACACCAAGATATTCGTCAAGTTCCCCAAGAAATTCTGGCCCGAAG
GGGCAGGGAGGGAGTTCTTCCTCTACGCGAGCACCAGGAGAGGCTACTACGGAGTCTGGC
AGGAGTTTGAGAAGCAATACCCGGATGCCAATGTGCTCCTGGTGACGGTGACCGACGAGG
AGTCGAGGCGGATCGAGCAGCAGCCGGACAGCCAGACCAAGGCAGAGATCATGGAGGTTG
TGAGGAGCATGTTCCCTGACGAGGACGTCCCCGACGCCACCGACATCCTCGTCCCGAGAT
GGTGGTCGGACAGGTTCTTCCAAGGCAGCTTCTCCAACTGGCCCATCGGCGTCAGTCGCT
ACGAACATGACCAGCTCAGGGCGCCGGTTGGGAGAGTCTATTTCACCGGTGAGCACACGA
GCGAGCGCTACAATGGCTATGTCCATGGAGCTTATCTTGCAGGTATCTATGCCTAATTTG
TTAGCCTATGTCTCTAATGTTAGAGAGACCGGAGATGTAAACCATTTTTATTGTCTTAAA
AAAATACCTGCTCTAGTGATTGACGAGATTTGTAATGCTAATATTTGTGCTTTATTATGT
GCTGTGCCTTTGCTTGTTTTTGTC

CDS

1425 bp

>Os09t0368500-01 Terminal catabolism-type polyamine oxidase, Anther development
ATGACGAAGCCCACGACGATGGCCATTTTTCTTTCTATAGTGCTACTATCCATGGCACAG
CTTCCCTCTCTCGTCGCCGGCACCGGCCGGCCAAGGGTCATAATCATCGGCGCCGGCATA
TCCGGTATTTCAGCGGGGAAGCGGCTGTCGGAGGCTGGGATAACGGACATATTGATCTTA
GAGGCAACAGACCACATTGGCGGGCGGATGCACAAACAGAGGTTTGCCGGCGTCAATGTG
GAGATCGGCGCCAATTGGGTGGAGGGCGTCAATGGTGAGAAGATGAACCCCATTTGGCCC
ATCGTCAACTCCACCCTCAAGCTTAGGAACTTCCTCTCCGACTTCGACAGTCTTGCCCAA
AACGTCTACAAGGACGGTGGCCTCTGCGACGCAGCATACGTGCAGAAGAGAATCGACCTG
GCTGATGAAGCGGATAAGAGTGGGGAGAATCTCTCCGCCACACTGCACCCAAGCGGCCGG
GACGACATGTCAATCCTTTCAATGCAACGGCTCAACAATCACCTGCCCAACGGCCCGTCG
TCGCCGGTGGACATGGTGGTGGACTACTTCACCTACGACTACGAGTTCGCCGAGCCGCCG
CGCGTGACCAGCCTGCGGAACACCGTTCCCCTCCCGACCTTCACCGACTTCGGAGACGAC
AACTACTTCGTCGCCGACCAACGGGGCTACGAGGCCGTCGTCTACTACCTCGCCGGCCAA
TACCTCGAAGCCGACAAGTCCGGCAACATCGTTGACGCTCGCCTGCAGCTCAACAAGGTG
GTGCGTGAGATCTCCTACTCCTCGACCGGCGTCACCGTGAAGACGGAGGACAACTCGACG
TACCAGGCAGACTATGTCATGGTTTCTGCGAGCTTGGGAGTCCTGCAGAGCGATCTCATA
CAGTTCAAGCCACAGCTGCCTTCTTGGAAGATTCTTGCGATCTACCAATTCGACATGGCC
GTGTACACCAAGATATTCGTCAAGTTCCCCAAGAAATTCTGGCCCGAAGGGGCAGGGAGG
GAGTTCTTCCTCTACGCGAGCACCAGGAGAGGCTACTACGGAGTCTGGCAGGAGTTTGAG
AAGCAATACCCGGATGCCAATGTGCTCCTGGTGACGGTGACCGACGAGGAGTCGAGGCGG
ATCGAGCAGCAGCCGGACAGCCAGACCAAGGCAGAGATCATGGAGGTTGTGAGGAGCATG
TTCCCTGACGAGGACGTCCCCGACGCCACCGACATCCTCGTCCCGAGATGGTGGTCGGAC
AGGTTCTTCCAAGGCAGCTTCTCCAACTGGCCCATCGGCGTCAGTCGCTACGAACATGAC
CAGCTCAGGGCGCCGGTTGGGAGAGTCTATTTCACCGGTGAGCACACGAGCGAGCGCTAC
AATGGCTATGTCCATGGAGCTTATCTTGCAGGTATCTATGCCTAA

Protein

475 aa

>Os09t0368500-01 Terminal catabolism-type polyamine oxidase, Anther development
MTKPTTMAIFLSIVLLSMAQLPSLVAGTGRPRVIIIGAGISGISAGKRLSEAGITDILIL
EATDHIGGRMHKQRFAGVNVEIGANWVEGVNGEKMNPIWPIVNSTLKLRNFLSDFDSLAQ
NVYKDGGLCDAAYVQKRIDLADEADKSGENLSATLHPSGRDDMSILSMQRLNNHLPNGPS
SPVDMVVDYFTYDYEFAEPPRVTSLRNTVPLPTFTDFGDDNYFVADQRGYEAVVYYLAGQ
YLEADKSGNIVDARLQLNKVVREISYSSTGVTVKTEDNSTYQADYVMVSASLGVLQSDLI
QFKPQLPSWKILAIYQFDMAVYTKIFVKFPKKFWPEGAGREFFLYASTRRGYYGVWQEFE
KQYPDANVLLVTVTDEESRRIEQQPDSQTKAEIMEVVRSMFPDEDVPDATDILVPRWWSD
RFFQGSFSNWPIGVSRYEHDQLRAPVGRVYFTGEHTSERYNGYVHGAYLAGIYA*

5'UTR

chr09:12176958..12176968 (- strand) : 11 bp

CDS

chr09:12176834..12176957 (- strand) : 124 bp

chr09:12174685..12174934 (- strand) : 250 bp

chr09:12172994..12173140 (- strand) : 147 bp

chr09:12168016..12168271 (- strand) : 256 bp

chr09:12167726..12167869 (- strand) : 144 bp

chr09:12167459..12167608 (- strand) : 150 bp

chr09:12167124..12167381 (- strand) : 258 bp

chr09:12166875..12166970 (- strand) : 96 bp

3'UTR

chr09:12166727..12166874 (- strand) : 148 bp

FASTA

>Os09t0368500-01 class=Sequence position=chr09:12166727..12176968 (- strand)
TGGAAGAGAG TATGACGAAG CCCACGACGA TGGCCATTTT TCTTTCTATA GTGCTACTAT CCATGGCACA GCTTCCCTCT
CTCGTCGCCG GCACCGGCCG GCCAAGGGTC ATAATCATCG GCGCCGGCAT ATCCGGTACG CACACAAGTA CTTTTACCGT
CGGTGATATC TACGTCACTC AGTATTCTAA GTTTACCGTC TACGTCACTC ATAGTATTCT AAGTGTTACT AATAGAAATG
ATGTTAGCTG TAATTTATGA ATTTATATCA CACATGTTAC ATGTTGTTAC TCCCTTCGTC TTAGATAAGG GAGTGTGTAT
TTTATGGCTG GTGCCCAATA TGCAAGATGT AATTTTAGTT TGATTCACTA TCTTCCTAGA TTACCCTTTC ATAATGTGTA
TGCATGCAAA CTGCCACAAC CTATACACGC AGAAAGCATG TGGGCATGCA AACCAACCAG GCATAACACT AACTCACTCC
TTAACTAAAG CCTTAGAACG CTagcatacc caactgatac ccacaaatct atctctaaaa ttatattttt gggatttata
atttaatttt aaggtgtaaa tagattttta tctctaacat atatcttgaa taaactcata ataataaaaa gtagacaaac
tcctaattac CAACATATAC ATAAACAAAA ATCGCTCTGC ATATCATCTC CCCACGCGCA ATCTCTCTCT ATGTGCCACC
CTCTCCTTTT GTTGTGCGGA AATTTGGAGT GAGAGTGTCT CTCAACCTGT GAAGAGCAAA AAAGGACAAG GTGATTCTAA
TTTTTCGGAT AAATATTTAA CACTACCACA TAAATGATTT TCCCATATGG CCAAAACTCA TTATTGTTGG CGGGTGGAGC
ACCTACCTGG AGCCAGGTAT Ctgcaaagaa aggcacttcc ccatgtggtt gcaacaactg catgcaaaaa tgcattcttg
cagtcaggcg tcttaaggag gccgcatgTA AAGACCTGAT TTTTGCATGC AATCAAGTAA GGATGTCTGA CTACAACGAT
TTTCAATAAT AATAATAATA ATAAAGAAAA AAAAAATCCA AAACCCTAGA TCAGGCACTG CCGCCACAGG CGTGAGTCCG
CCACTACCAA GGCTGCGCCG TTGGATCCGT GAGGAAGAGG ACCACTGTCG TCGTCATCGA TGCAGTCCGC TGCCTGCCGT
TGTCAACATC GCGACCCCAC CGCACCCAAA GCCAGCGGCG GTGGATCCAA GAGGGAGAGG GCCACCGCCG CTAGATCCGT
TAGAGAGAGG GCCCTACCGT CGTCGCCATT GATACCCCGC CGCACCAGAG GCCACCTGTC CGCCTGTCCT GAGGCCGTTG
CCGCCGGATC CGTGAGGGAG GAGGGCCCCC GCCGTAGGAT CCGGCTAGGA GAGGGCCCCC ACTGTTGTCG TCATCGATAC
CCCACCGCAC CAAAGGCTGG TGGCGGATCC GCCCTCCCGA GGCTACTACC GCCGGATCTG CAAGGGGGAT GGCCCCTACT
ACCGGATCCA CGCAGGGCAG GGTCGCTACC ATCGGATCCA TCGAGGAGGC TACGCCGCTG CCGCCGTTGA CGTGCTTCCC
CGCCGTCATC ATCATTGATA TCCTGCAGCA CCAGAGGCCA CCGCTGGTAG ATGCACCCCT CTCGAGGCTT CCGCCACCAG
ATCCGTAAGG AGGAGGGCCG CCGCCGAATC CGCCGAGGAG GCTACGCCAC CGCTGCTGTC CACGCACGCC TCTCCTCCAC
CGGCTTCAGT TTTAGAATTA GGTTTATTTA AGGATATTGT TGGTCATGCT CTTAATTCAC TCTCTCCTTG ATATTAGGAA
AAAAAATTAG GAAAAAAAAG TGCACCCTCT AATTAACGAC GAAGGGAGTA ATTTATGCAG AAGCTATAAG AACAATTATA
GTCCCATAGA TGTGTGCTGG TAACCCAGGT GCTTGCTTTA AATCCTGATC TTCATACATA AACTAAGACG ACATATAGTT
CTATATAGAT GTACATCTAT GTTGTGTTGT GCAGGTATTT CAGCGGGGAA GCGGCTGTCG GAGGCTGGGA TAACGGACAT
ATTGATCTTA GAGGCAACAG ACCACATTGG CGGGCGGATG CACAAACAGA GGTTTGCCGG CGTCAATGTG GAGATCGGCG
CCAATTGGGT GGAGGGCGTC AATGGTGAGA AGATGAACCC CATTTGGCCC ATCGTCAACT CCACCCTCAA GCTTAGGAAC
TTCCTCTCCG ACTTCGACAG TCTTGCCCAA AACGTCTACA AGGAGTACGT ACATTCCATG AGTGGGTGGA TCGATTGAAA
TAATTAAAAC TCGACACATG ATTAATTATA CAGATTTCTC TAAAAACATA TTTTGCACAT ATTTACGTGT GCGCATCATA
GTAATAGACA AGCACTAATC ATCTGCCAAT TCCAATCTGT CACCGCTGTT GGTTTGGGAA AAAAAGAGAG TAATTAATGC
CCAGTTGTCA GAAGTACTCC ACCTATTCAC CTTTCATTTA TCAACAAGAG AGAGACTAAT AAAAAAAAAC TTTTTGCGGC
CCATGAAATG GAATAGTATA CTTCTAAATA AATTAAAATA TATATGCAAC TTCTAACTAG AAATTTGAAA TGTTAATGAA
AATTTCAAAA AGAGACTGAA AAACTTTCAA AATGCAAAGT TTCTGTTGAG ATTAAAACTT TCATATCATT AAATATTAAA
ATGGCCATAG GTAACTGTTT TGGACATCCA TATTTGTCAT TTAAACAGTA TAGTTTTGAA CATTAACTTC TACTCGGCTG
CTAGCTGCGA GAAAGTTATA TAAAAAGAAA TTACGTTATA TATATAGAAT TTTACTTCAC ATGGTTTGGC CAAATAACAT
ATAAATAAAA CCTCCAATTA TAGAAATATA AATAATGTAG CCATATAAGA AAAAAATAAA TAATAGATCG ATGATCTAAA
CATGAAAAAT AATTTGAGGA AATCCTCCAA TGCTAAAATT ATAGACAATG TAGCTTCCGT AAGAGAGAAG AGATAATAGA
TCGGGTCCAA ATGCTGAAAA TAATTTGAGG TAATTGTGAT AGAAAAAGCT AGAAACAAAA GATGGTATGC ATTAATTGGA
ACAGATTCAT GCAGGGTATG CAATTTCGGT AACACCGAAA TTTTTGTGGT TGCCAAAATT TAAAAAAAAT CATGGATTTC
AGTGTTTTTT TACCGAAATT ATTTAAAAAT TTAACATCTT TTGACTTAAT TGAAACAAAT TTTGATCAAA TTCATAAATA
TTTGAAAAAC CAAAAATTCC AGAGGAGATT TGTGCTTGTT GGTACGGTCT GAAATTACCA AAATTTCTAA AATTTAAAAC
CGAAATTGCA AACCATGGAT TCATTGAGAg gagatggcaa tttgcatcat gcataagtga tctaaaggct agaaacagat
gaagtgacgt ggcttaatta gagaagatag gattagcatt ATCTTAATGG AGATTCAACT TTGTTAGAAT AAATCAATAA
AGTCAACGTA TAACAAACAA AATATAAATT TAAGTTTTGA TCTTTCGAAA AATAGTAGTA CATATACTCA GACAAATTAA
CGCATATGGA TATATACCCA AGTTTCAACT AGGGTACATA TATATGTTCA AACCGATGAA TGTTTGTGAG TGACATGAAT
AGATTTTACA GCAAAACTTA ATTAATTGTG TTTTCAGACA ATAGAAACAA ACTATGCATG CAAATATATT ATTGCATCCA
AAATATATAT ATCCTACTAG CATACATATG CATGTTGCAT TATATTGCCT GAAGTTGAAT AATTTCAGCG GTGGCCTCTG
CGACGCAGCA TACGTGCAGA AGAGAATCGA CCTGGCTGAT GAAGCGGATA AGAGTGGGGA GAATCTCTCC GCCACACTGC
ACCCAAGCGG CCGGGACGAC ATGTCAATCC TTTCAATGCA ACGGCTCAAC AATCAGTACG TGCCTTTGCC GCTCAAGTCT
TTACTTAAAA ATAAAATTTA AGCACTTAGA AAACACTTCA AAAGCTATTT GAATTGATCA TTCATGTATT TCAAATAGTA
GCTCCAAAAC AAATGGAATT TGCTTAGGCT TGTGGGCCTC TGAAAAGTTG TAGGCTTGTG GGTTTAGGCC CAAAATGAAA
CTAATAACCA GTCTAGCAGA TACAGAGATA CTTCCTCATG CAGGAATGAA TACGAAACCA ATCTATCTAT CTATtatcta
ttattattta ctaaaaatcc atgaaacttc ctacaaacac tcataagccg ccacgtggca ctcctacaaa cgctcctaaa
ccgtcacatg gcacttttaa tctaaccgtc gattttcact taaattggtg gacccactgt tttagactat tagattagat
ctatttagaa aagtcccagc ttcatcgaaa ttataccaga aaaattaatg tacataccgg atataaacct tccgtattgt
tctcttaaaa aaaccaaaca gacgtatacg tacgtacgaa gattaaaaaa aaaccaaaaa accatatgta tgccgtaaga
acaatacggt ctttcgaata tagtgtagta cgtattgtgt atgcctttct ctgtttttta tttatcaatg aacagcaagt
acatacttaa gacttatcta tctatccacc gtctttaaaa taggatttcc tatattataa aataaaattt attactccac
aaatatgcac tgttaaacta gattaatata aagtaccaaa tcaactgtct ttaaatgttc atcttttaaa TTATTTCTCA
AATATATATC TAACTTATAA TCCTTTGTCT TTCTTTAATT AAATAAAATA CTAATCACTT ATAATCACTT ATAATAGTTA
TATGTTATAT GGAACTGCTA AATTCATTAC GACACATGGT GCCAACATAT AATACGTAAT GTGATAATTA TTTTTCAAAT
AATTTAGTTA ACATATAATA ACTAATGTCA TGATCATTTT TAAAATAATT TCACATGACA AAAATGATCA ACTTGGTGTC
AAATTCGCTT GACAAATATA TAACACTAAT TCAAATCTAC ATGCAGAAAA AGTGAAACAA CATTGTGGTT TACAATCAGA
TTTGATTTTA TTTTAATTTA TGTGATATTG AGATTCTCTT TTTTTTAAAA AAAATAGAAC TATTTGATGG GAATTTCCAG
GCAAAGACCT TGCTATATTA CGACCCCTTA ATCCATCAGG AGAATTACGG TCATATATTG TTTTTCTTTG CGAAATTGGT
TTGGTAACAA ATGAAAAATC ATTTGCATCA AACTATTCAT CATATATTTT TTATACTTTA GAAATTCTAA TATATCAAAC
ATAATTGATG ATGTATGTCA TACACCCCAC TGAAGTAACT ATAAATGCAC TCCAACAAAT TAGTTACTTT AAATAATTTT
GGAAAATATA TTCTTAGAAT TAGTAAAGAT GTCACATGTA ATTATGAACA ATACATGAAT GAAAACAAAC TGAAGCTAAA
CTATATATCT TAGTCAAAAT ATAAAGAACA ATATGGTACT CCTAGATGTC ACGGTCGTAT GTCTGTTTAG TTATATTTTT
TTTATCAACC TTGCTCATCT GAAAAGAGAA TATTGTATCT ACACAATAAA AAAAAAGCAT TACTGATTAA TACCATGCAC
AATTTTGTCT ACACAAAACT ATGAAAAAAT TCACTAGGGA AATATTTTCA TCACCAACAT TCCCTCTTTT TTTTCCCATA
AAGGGCACCA AGCATGCTGT GCTACCACAA GTGTAGCAAA TGTCATACAT ATGGTTGAGT TGAAGCCACC CCGGCAAAGG
CCACTATTGA CAATAGTGTA TAACTTTGTA CTTACTGATG CAATTATCTA TGAGGGTGCT GATAGTGAAC TAGACATTAA
AATTATGCTT CATGCTGGCA TTGCGGGGCA TAACTATGTC GACTCAAGAC CTATGTTTAA AGGCAGTGGA GAAATAAAGC
CTCGACAGAT ACGGTTAGCT TCACCCATTA AAGGGGACAT TCATATATGA TTTTAACGGT CATCAAAGtt aaaaaatctt
ataaattata agaaaaaaat gatcaacggt ttacttaaat tatttagaaa aaaaatagaa aaataaagtc cccaaaacct
cgtcctcccc ggcacatgca caaaacattg ccggtcccct tcaaccttgg ctcatgctct ccgctctcca ttcctccccc
ttcctatgaa taatactgaa aagaccatat ttttaatata tacataacat ttctaatcta attattgctc tgttaaataa
ttaaaccaac aattcttgat ccataatgcc tatattttta atctaaaata agacttgtaT AAAATAAAAT AGAAAAGTAG
AAAAAAAGTC AATAGGGATT GAATCAAATC AATTAGAGAG AATATAGTAA TAAATTTCTG AAAAATAGAA AATTGGAACA
ACCATTGTAT GTTCCATTGC CATAACCATC CATCTATCGT GGTATTATGA GTTTCTCATA TATTATTGCA TATATAAGAC
ATACTAAGGT AGCTGGACGT AGTAGTACTT AGTTGGTTAA AAAGTTATAT ATATATGCTA CTATCAACTT TAAATTTAGG
ACTCATGTTG CCTAGGGTTT TTTTTAAAAG AACACCATAA ATCACATATA TAAAAGGGAA AGGACGCGTA AAATATATAT
ATCTCCTATG TATTTATTGT CTCATTCTTT CAAGAAAATA AAGAAGATCA TTGATAATTG CTTATAGTAA TGAATTAAAT
ATTATATAGT TCAAACCTTA CAAATGTCTT GTAAAAAATT ATCTAAGCAA TAGCGATGAA GAAAATTTAT AAAGAAATAc
tccctccgtc ccaaattata ccaactataa tcaaactcgg taccttttaa ctaataatca tactaactat atctaagtat
tatgcatgtt acatcactag atttatattt tgaagtactt tcatgtgatg ctaatttcat atttgttggg atagaatgga
ataaagtact ggtcaaaata tgttattaaa acctgtgtaa aaaaatatag gtcttataat ttgagacaga gggagTAGTA
TTTTTCAAGC ATAGCAGGTA TTGTCCGATT GATACTCCAT CATCCGATTG ATATTCCCAG tgtaacctac tttacatgcc
cacgcgaatg cgcgggctac cttcctagTT CTACcagaaa gggtaaatga tagtaccaga aaaccaaatc tcttttaact
aaaatagccc ttaaacctca cgaagtttgg tctgactgat gtatatgcgc gtcagtctga ctccgtagtc ctgctgatct
aatcaccgtg tgcgatgaat ctgcctgcct actcgtcacc gctggttaaa ccgcccgtcg agtagaccgc ttgtctgatg
ctggtctgac cATTGAGATC CAAAaaaaac acgtctcgac aaaactctta aaagtagatc aaccgtattg tatcaaattg
tgtttacaaa tcgcatctaa agcactgctc tttcacctca tgtactagag tcaaagtctc aaagcaagaa ctaacttttc
tcccttaaaa gtcgatatac tcctaatatc aacccctcgc ctatttatac ataaaacata gctgtaccta gccatgaatc
ctactggaac taggaatcct aatcacacaa aaaaacccct ctcgaaccag gaaaacaaca tccctataca acaccaaact
tctcaaactt aggctctaat ctaaatttga ctctactttc catacacaca caacaccacg tgtatgccat aagagaactc
atgtatattg ttctctagtc tgagcatctc gcatgatctc gttgatcatt tgtacctcaa gtaatgcaaa atttcatatc
caagcacaag ttcacaccaa cttgtctcac atcatcatgc aaatagtatc acatatgtat ctaaaccatt tagaagtcat
gaatatgaac cgattttaaa aatcgacaaa accaacctga aCATAGATGA AAAaccgaaa acattattcg tcgtattttc
acatatactt atctttgaca attatttttc accaagatta catcatcaca tgatttcaca cctccaaatt ttaatatatg
atgccattgg cattgttaga tacttttggt tgtccatatt aattttgtta ttatttgatt tgtcaataaa tatttttaag
catgactgat atgttttatg cttaaaattt ttaaataaga cgaataacta aatgtcaacg gcaacgtata ttaaaaaccg
atagagtTTT TTTGGCCGGG CCAGTGGACG GCGTCGGCCA ATGTATTAAG CATGGGAAAG AAAAACATTT TACAAACAAA
CAACAGTCAC TGCTGTCGGG AAACTAGAAC ATACACCGGT AGTAGGCTGG GTTAGGCCAG AGACTAAATA TATAACTGGC
CCGCCTGACA GATAGTATAC AACATACTTC TATGTAAAAC AACTTAATTC TAAAGATGTA TCTAGATAAC GTGTATGTCC
AAATACAAGC TCAGAAATGG ATTAGAATTA AAAAAAATTT TAAAGATAGA GGGAGTAGTA CAATAGTTGT ACAAGCTGTG
ATTCAGTCTC TCTGTTCTTC TGGGTGGTGG TGGCGTGCAA ATCCATGAAA TGGCCAGCCT GCCCAACGGC CCGTCGTCGC
CGGTGGACAT GGTGGTGGAC TACTTCACCT ACGACTACGA GTTCGCCGAG CCGCCGCGCG TGACCAGCCT GCGGAACACC
GTTCCCCTCC CGACCTTCAC CGACTTCGGA GACGACAACT ACTTCGTCGC CGACCAACGG GGCTACGAGG CCGTCGTCTA
CTACCTCGCC GGCCAATACC TCGAAGCCGA CAAGTCCGGC AACATCGTTG ACGCTCGCCT GCAGCTCAAC AAGGTGGATC
GATCACTTCT GTTTCTGTAA CTCATCTCGA TCAGCTCCTG CGCTAATGCT ACGATTGTTT TCGTAATTGG TCTTTTCTGT
CAGAAAAGAT GAACTGATTA AGCACGCGAT CATCATGGTG GTATATATGA TCGATGCAGG TGGTGCGTGA GATCTCCTAC
TCCTCGACCG GCGTCACCGT GAAGACGGAG GACAACTCGA CGTACCAGGC AGACTATGTC ATGGTTTCTG CGAGCTTGGG
AGTCCTGCAG AGCGATCTCA TACAGTTCAA GCCACAGCTG CCTGTCAGTT TCTATGTCCA AATGTCCTTG CATGTTCAAC
ATATCCTCTT CCAAATATAA ATTAAGATGT GCATATCGAG CAGTCAAATT TACTTTACGT TTCTTGCATG TTTCCATCAG
TCTTGGAAGA TTCTTGCGAT CTACCAATTC GACATGGCCG TGTACACCAA GATATTCGTC AAGTTCCCCA AGAAATTCTG
GCCCGAAGGG GCAGGGAGGG AGTTCTTCCT CTACGCGAGC ACCAGGAGAG GCTACTACGG AGTCTGGCAG GTACAAAATA
TGCAGCAATA TATACAATCC ACTCACATCG AATTGTAGTA CATTGCGATG ATCTGAACAT TCTTCAGGAG TTTGAGAAGC
AATACCCGGA TGCCAATGTG CTCCTGGTGA CGGTGACCGA CGAGGAGTCG AGGCGGATCG AGCAGCAGCC GGACAGCCAG
ACCAAGGCAG AGATCATGGA GGTTGTGAGG AGCATGTTCC CTGACGAGGA CGTCCCCGAC GCCACCGACA TCCTCGTCCC
GAGATGGTGG TCGGACAGGT TCTTCCAAGG CAGCTTCTCC AACTGGCCCA TCGGCGTCAG TCGCTACGAA CATGACCAGC
TCAGGGTACG AGCTGTTACT CCAACCAAAT GCTAATCGCA ATTCACTACA GATCATGTTT TTCATTGCTA CTTTGATGTT
TCTTTGGTCA TGAACAAATG AGGTTTAAAT TTGAGCTTAA TTTGGTTTTG TGTATGTTTT GCTGTTTCTG CACACAAGGC
GCCGGTTGGG AGAGTCTATT TCACCGGTGA GCACACGAGC GAGCGCTACA ATGGCTATGT CCATGGAGCT TATCTTGCAG
GTATCTATGC CTAATTTGTT AGCCTATGTC TCTAATGTTA GAGAGACCGG AGATGTAAAC CATTTTTATT GTCTTAAAAA
AATACCTGCT CTAGTGATTG ACGAGATTTG TAATGCTAAT ATTTGTGCTT TATTATGTGC TGTGCCTTTG CTTGTTTTTG
TC

Locus: Os09g0368500

Loading...

Locus: Os09g0368500

Loading...