Os09t0375300-00

Locus

Os09g0375300

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL41, TBL41

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 41

Transcript Evidence

ab initio prediction

Protein Evidence

Q6H5G7 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Expression Databases

TENOR (Os09t0375300-00)

Others

Oryzabase (21496)

KEGG (Os09t0375300-00)

Transcript

1338 bp

>Os09t0375300-00 Similar to predicted protein.
ATGGGCGCCGCCTCCACGCCTCGCCACCATCTCCCCCTCCCCAAGCGGATCTTCGCCTAT
GCCCTCTACGCCCTCCTCCCCCTCGCCGCCCTCCACTACCTCCTCCTCTCCCCTCCCCCT
CCTCCCCTCGCCACCACCTCCACCTCCACCACGCCGCCGGTTGCGGCGGTGGCGGTGGCG
AGGAAGGCGGCGCCGCGGTGCGACTACTCGGAGGGGGAGTGGGTGCGGAGCGCGTCGGCG
CCGCGGTACAACGGGACGAGCTGCGGCTCGACGATCAAGGGCGGGCAGAACTGCATGGCG
CACGGGCGGCCCGACACGGGGTACCTCCACTGGCGGTGGCGCCCGCGCGGCGGCGGCGGG
TGCGCGCTGCCGCCGTTCGCGCCGGGGGAGTTCCTGGAGCTGGTGCGCGGGCGGCACGTC
GCGTTCGTGGGAGACTCGCTGGCGCGGAACCAGTGCGAGTCGCTCGTCTGCCTCCTCGCC
TCGGGGTTCCCCGCCGAGCTGGTGCGCGGCGGCAACGGCGGGGACGGTGGGGACGGGGAC
GAGGCGCGGAAGTTCCGGCGGTGGGTGTTCCCGTCGCACAACGCCACGGTTTCGGTGTTC
TGGTCGCCGTTCCTGGTGAACGGCACGGAGAAGTCGTCGTCGTCGGCGGCGGCGGCGGGG
GCGGGGGGGCTCGACCACAACCGGCTCTACCTGGACCAGCCCGACGAGCGGTGGGCGGGG
GAGCTCGACGGCATCGACGTGGTGGTCCTCTCCGCCGGCCACTGGTTCCTCCACCCGGCG
ATGTACTACGAGCGCGGCGAGGTGATCGGCTGCCACCACTGCCCGGAGCCGAACCGGACG
GAGACGGGGTTCTTCGGCGTGTTCCGCCTCGCCGTCAAGAACGCCCTCCGCGAGGTCATC
ACCCGCGCCGCCCGCTCCCCGTCGCAGCAGCAGAAGCTCGCCGTGGTGACGACGTTCTCG
CCGGCGCACTTCGAGGGGGAGTGGGACGCGCGCGACGCGTGCGCGCGGTCGGAGCCGTAC
GCGCCGGGGGAGAAGGAGGTGGGGTACATGGACCGGGAGATGGGGCGCGCGGAGGCGGAG
GAGGTGGCGGCGGCGGCGGCGGACGCGAGGGTGCGCGCCCCCGGTCGCGTGGAGGTGGAG
GCGCTGGAGGTGACGGCGATGGCGGCGCTGCGCGGCGACGGGCACCCGGGGCCGTACATG
AACGCGTTCCCGTTCGCCGGCGGCGAGAGGGCGCGGGTGCCCAACGACTGCGTGCACTGG
TGCCTCCCGGGCCCCATCGACACGTGGAACGAGATCCTCCTCCAGCTCGTCAAACGATGG
AGAGACTCCTCGAAATGA

CDS

1338 bp

>Os09t0375300-00 Similar to predicted protein.
ATGGGCGCCGCCTCCACGCCTCGCCACCATCTCCCCCTCCCCAAGCGGATCTTCGCCTAT
GCCCTCTACGCCCTCCTCCCCCTCGCCGCCCTCCACTACCTCCTCCTCTCCCCTCCCCCT
CCTCCCCTCGCCACCACCTCCACCTCCACCACGCCGCCGGTTGCGGCGGTGGCGGTGGCG
AGGAAGGCGGCGCCGCGGTGCGACTACTCGGAGGGGGAGTGGGTGCGGAGCGCGTCGGCG
CCGCGGTACAACGGGACGAGCTGCGGCTCGACGATCAAGGGCGGGCAGAACTGCATGGCG
CACGGGCGGCCCGACACGGGGTACCTCCACTGGCGGTGGCGCCCGCGCGGCGGCGGCGGG
TGCGCGCTGCCGCCGTTCGCGCCGGGGGAGTTCCTGGAGCTGGTGCGCGGGCGGCACGTC
GCGTTCGTGGGAGACTCGCTGGCGCGGAACCAGTGCGAGTCGCTCGTCTGCCTCCTCGCC
TCGGGGTTCCCCGCCGAGCTGGTGCGCGGCGGCAACGGCGGGGACGGTGGGGACGGGGAC
GAGGCGCGGAAGTTCCGGCGGTGGGTGTTCCCGTCGCACAACGCCACGGTTTCGGTGTTC
TGGTCGCCGTTCCTGGTGAACGGCACGGAGAAGTCGTCGTCGTCGGCGGCGGCGGCGGGG
GCGGGGGGGCTCGACCACAACCGGCTCTACCTGGACCAGCCCGACGAGCGGTGGGCGGGG
GAGCTCGACGGCATCGACGTGGTGGTCCTCTCCGCCGGCCACTGGTTCCTCCACCCGGCG
ATGTACTACGAGCGCGGCGAGGTGATCGGCTGCCACCACTGCCCGGAGCCGAACCGGACG
GAGACGGGGTTCTTCGGCGTGTTCCGCCTCGCCGTCAAGAACGCCCTCCGCGAGGTCATC
ACCCGCGCCGCCCGCTCCCCGTCGCAGCAGCAGAAGCTCGCCGTGGTGACGACGTTCTCG
CCGGCGCACTTCGAGGGGGAGTGGGACGCGCGCGACGCGTGCGCGCGGTCGGAGCCGTAC
GCGCCGGGGGAGAAGGAGGTGGGGTACATGGACCGGGAGATGGGGCGCGCGGAGGCGGAG
GAGGTGGCGGCGGCGGCGGCGGACGCGAGGGTGCGCGCCCCCGGTCGCGTGGAGGTGGAG
GCGCTGGAGGTGACGGCGATGGCGGCGCTGCGCGGCGACGGGCACCCGGGGCCGTACATG
AACGCGTTCCCGTTCGCCGGCGGCGAGAGGGCGCGGGTGCCCAACGACTGCGTGCACTGG
TGCCTCCCGGGCCCCATCGACACGTGGAACGAGATCCTCCTCCAGCTCGTCAAACGATGG
AGAGACTCCTCGAAATGA

Protein

446 aa

>Os09t0375300-00 Similar to predicted protein.
MGAASTPRHHLPLPKRIFAYALYALLPLAALHYLLLSPPPPPLATTSTSTTPPVAAVAVA
RKAAPRCDYSEGEWVRSASAPRYNGTSCGSTIKGGQNCMAHGRPDTGYLHWRWRPRGGGG
CALPPFAPGEFLELVRGRHVAFVGDSLARNQCESLVCLLASGFPAELVRGGNGGDGGDGD
EARKFRRWVFPSHNATVSVFWSPFLVNGTEKSSSSAAAAGAGGLDHNRLYLDQPDERWAG
ELDGIDVVVLSAGHWFLHPAMYYERGEVIGCHHCPEPNRTETGFFGVFRLAVKNALREVI
TRAARSPSQQQKLAVVTTFSPAHFEGEWDARDACARSEPYAPGEKEVGYMDREMGRAEAE
EVAAAAADARVRAPGRVEVEALEVTAMAALRGDGHPGPYMNAFPFAGGERARVPNDCVHW
CLPGPIDTWNEILLQLVKRWRDSSK*

CDS

chr09:12555490..12556827 (+ strand) : 1338 bp

FASTA

>Os09t0375300-00 class=Sequence position=chr09:12555490..12556827 (+ strand)
ATGGGCGCCG CCTCCACGCC TCGCCACCAT CTCCCCCTCC CCAAGCGGAT CTTCGCCTAT GCCCTCTACG CCCTCCTCCC
CCTCGCCGCC CTCCACTACC TCCTCCTCTC CCCTCCCCCT CCTCCCCTCG CCACCACCTC CACCTCCACC ACGCCGCCGG
TTGCGGCGGT GGCGGTGGCG AGGAAGGCGG CGCCGCGGTG CGACTACTCG GAGGGGGAGT GGGTGCGGAG CGCGTCGGCG
CCGCGGTACA ACGGGACGAG CTGCGGCTCG ACGATCAAGG GCGGGCAGAA CTGCATGGCG CACGGGCGGC CCGACACGGG
GTACCTCCAC TGGCGGTGGC GCCCGCGCGG CGGCGGCGGG TGCGCGCTGC CGCCGTTCGC GCCGGGGGAG TTCCTGGAGC
TGGTGCGCGG GCGGCACGTC GCGTTCGTGG GAGACTCGCT GGCGCGGAAC CAGTGCGAGT CGCTCGTCTG CCTCCTCGCC
TCGGGGTTCC CCGCCGAGCT GGTGCGCGGC GGCAACGGCG GGGACGGTGG GGACGGGGAC GAGGCGCGGA AGTTCCGGCG
GTGGGTGTTC CCGTCGCACA ACGCCACGGT TTCGGTGTTC TGGTCGCCGT TCCTGGTGAA CGGCACGGAG AAGTCGTCGT
CGTCGGCGGC GGCGGCGGGG GCGGGGGGGC TCGACCACAA CCGGCTCTAC CTGGACCAGC CCGACGAGCG GTGGGCGGGG
GAGCTCGACG GCATCGACGT GGTGGTCCTC TCCGCCGGCC ACTGGTTCCT CCACCCGGCG ATGTACTACG AGCGCGGCGA
GGTGATCGGC TGCCACCACT GCCCGGAGCC GAACCGGACG GAGACGGGGT TCTTCGGCGT GTTCCGCCTC GCCGTCAAGA
ACGCCCTCCG CGAGGTCATC ACCCGCGCCG CCCGCTCCCC GTCGCAGCAG CAGAAGCTCG CCGTGGTGAC GACGTTCTCG
CCGGCGCACT TCGAGGGGGA GTGGGACGCG CGCGACGCGT GCGCGCGGTC GGAGCCGTAC GCGCCGGGGG AGAAGGAGGT
GGGGTACATG GACCGGGAGA TGGGGCGCGC GGAGGCGGAG GAGGTGGCGG CGGCGGCGGC GGACGCGAGG GTGCGCGCCC
CCGGTCGCGT GGAGGTGGAG GCGCTGGAGG TGACGGCGAT GGCGGCGCTG CGCGGCGACG GGCACCCGGG GCCGTACATG
AACGCGTTCC CGTTCGCCGG CGGCGAGAGG GCGCGGGTGC CCAACGACTG CGTGCACTGG TGCCTCCCGG GCCCCATCGA
CACGTGGAAC GAGATCCTCC TCCAGCTCGT CAAACGATGG AGAGACTCCT CGAAATGA

Locus: Os09g0375300

Loading...

Locus: Os09g0375300

Loading...