Os09t0376800-01

Locus

Os09g0376800

Description

Similar to Trehalose-6-phosphate synthase (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

TPS11

CGSNL Gene Name

TREHALOSE-6-PHOSPHATE SYNTHASE 11

Oryzabase Gene Symbol Synonym(s)

OsTPS11

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067023 (DDBJ, Best hit)

Protein Evidence

B6SH67 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: trehalose biosynthetic process (GO:0005992)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Glycosyl transferase, family 20 (IPR001830)

Full-length cDNA

J013092M02 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0376800-01)

RiceXPro (AK067023)

Others

Oryzabase (9050)

KEGG (Os09t0376800-01)

Transcript

1832 bp

>Os09t0376800-01 Similar to Trehalose-6-phosphate synthase (Fragment).
CGAGTCTTACAAACATTTCTTCTCCTCTCTCTCTCTCTCTCTCTCTCAACTCCACCACAT
TTGTCTGTGTTCTTGCTGTCTCTTCTTCTCCTACTTCCTCTACTCGATTCGAGGTTTGgc
tgctgctgctgttgctgctgatagtggtggtggtgggtgggagcagAAGCAGAAGCAGGA
GGCAAAGAAAATCTCGAGGAAGGAAGCAGAAGAAGCAGCCAAGAAACGCCGCCATCTCAT
CTGGATGCGCTGAATCTATCTGCCGCGGTGGAGGTTGTGGAATCATGGTTTCAAAGTCAT
ATACAAATCTTCTAGATATGAGTGGTGAAGATGTGTTTGACTTTCAGCAACCATTTAGAT
CGCTTCCTCGTTTTGTGACTTCCCCAAGCATCACATCTAATCCTGATTGGGATACAAGTA
ATGCTGATGATTCAGTTGGTCCTGCATCTTGCTGTGTAAGGAAAATAATCGTCTCCAACT
TTCTTCCACTAAACTGTACCAAAGATGAAGCTACTGGACAGTGGTCCTTCTCAATGGATG
ACAATCAACTTCTTGTTCAACTTAAAGATGGATTTCCAATGGAGAGCGAAGTTGTTTATG
TGGGTAGCTTGAACGCTGAAGTTGATCCTGGTGAGCAAGATCAACTTTCACAGAAACTTT
TCAGAGAATACAAATGCATACCTACTTTCCTCCCAGCTGACCTCCAGCAGCAGTTCTATC
ATGGATTCTGTAAACAACAATTATGGCCACTTTTCCATTATATGCTTCCTATTTGCCTCG
ACAAAGGCGAGCTCTTTGACCGCTCTCTATTTCAAGCCTATGTTCGGGCAAACAAAATAT
TTGGTGACAAAGTTATGGAGGCCATCAATTCAGATGATGACTGTGTGTGGGTTCATGATT
ATCACCTCATGCTTCTCCCAACCTTTTTAAGAAAAAAGCTTCATCGCATCAAAATTGGTT
TCTTCCTTCACAGTCCATTTCCCTCCTCTGAAATCTATAGGACACTGCCAGTAAGAGATG
AAATTTTGAAGTCTCTTCTGAATGCTGATCTCATTGGCTTTCAAACATTTGACTATGCCC
GCCACTTCCTTTCATGTTGCAGCAGATTGTTAGGCCTTAATTACGAGTCAAAACGTGGTC
ACATCGGTATAGAGTACTTTGGCCGTACGGTGAGCCTCAAGATCCTTGCTGTGGGTGTAC
ATGTTGGTCGTCTTGAGTCTGTGTTGAGGCTGCCTGCCACAATTAGCAAGGTTCAAGAAA
TTGAGCAAAGATATAAGGGTAAGATGGTGATGTTGGGTGTAGATGATATGGATATCTTCA
AAGGGATCAGTCTAAAATTGCTTGGCTTGGAATTTCTTTTGGAGAGAACTCCAAAGCTAA
GAGGGAAGGTTGTCCTTGTGCAGATTATAAATCCTGCAAGAAGCACTGGAAAAGATGTGG
AGGAAGCAATAAATGAAGCCGTCTCTGTAGCTGAAAGGATAAACATTAAGTATGGTTCTG
CTGAGTACAAGCCTGTCATCCTTATCGACTACCCCATACCTTCTTATGAGAAGATTGCAT
ACTATGCTGCATCTGATTGCTGTATTGTAAATGCTGTGAGGGATGGGATGAACTTGATAC
CATATGAGTATACTGTCTGCAGGCAGGGAAATGAGGAGATTGATAAGCTCAGAGGTGTTG
ATAAGAGCTCACATCACACAAGCACACTAATTGTGTCTGAGTTTGTTGGTTGCTCCCCAT
CACTTAGTGGTGCTTTCAGGGTAAATCCTTGGAGTATTGAAGATGTAGCTGATGCATTAT
ATAAAGCAATGGATTTGACTCAATCGGAGAGG

CDS

1548 bp

>Os09t0376800-01 Similar to Trehalose-6-phosphate synthase (Fragment).
ATGGTTTCAAAGTCATATACAAATCTTCTAGATATGAGTGGTGAAGATGTGTTTGACTTT
CAGCAACCATTTAGATCGCTTCCTCGTTTTGTGACTTCCCCAAGCATCACATCTAATCCT
GATTGGGATACAAGTAATGCTGATGATTCAGTTGGTCCTGCATCTTGCTGTGTAAGGAAA
ATAATCGTCTCCAACTTTCTTCCACTAAACTGTACCAAAGATGAAGCTACTGGACAGTGG
TCCTTCTCAATGGATGACAATCAACTTCTTGTTCAACTTAAAGATGGATTTCCAATGGAG
AGCGAAGTTGTTTATGTGGGTAGCTTGAACGCTGAAGTTGATCCTGGTGAGCAAGATCAA
CTTTCACAGAAACTTTTCAGAGAATACAAATGCATACCTACTTTCCTCCCAGCTGACCTC
CAGCAGCAGTTCTATCATGGATTCTGTAAACAACAATTATGGCCACTTTTCCATTATATG
CTTCCTATTTGCCTCGACAAAGGCGAGCTCTTTGACCGCTCTCTATTTCAAGCCTATGTT
CGGGCAAACAAAATATTTGGTGACAAAGTTATGGAGGCCATCAATTCAGATGATGACTGT
GTGTGGGTTCATGATTATCACCTCATGCTTCTCCCAACCTTTTTAAGAAAAAAGCTTCAT
CGCATCAAAATTGGTTTCTTCCTTCACAGTCCATTTCCCTCCTCTGAAATCTATAGGACA
CTGCCAGTAAGAGATGAAATTTTGAAGTCTCTTCTGAATGCTGATCTCATTGGCTTTCAA
ACATTTGACTATGCCCGCCACTTCCTTTCATGTTGCAGCAGATTGTTAGGCCTTAATTAC
GAGTCAAAACGTGGTCACATCGGTATAGAGTACTTTGGCCGTACGGTGAGCCTCAAGATC
CTTGCTGTGGGTGTACATGTTGGTCGTCTTGAGTCTGTGTTGAGGCTGCCTGCCACAATT
AGCAAGGTTCAAGAAATTGAGCAAAGATATAAGGGTAAGATGGTGATGTTGGGTGTAGAT
GATATGGATATCTTCAAAGGGATCAGTCTAAAATTGCTTGGCTTGGAATTTCTTTTGGAG
AGAACTCCAAAGCTAAGAGGGAAGGTTGTCCTTGTGCAGATTATAAATCCTGCAAGAAGC
ACTGGAAAAGATGTGGAGGAAGCAATAAATGAAGCCGTCTCTGTAGCTGAAAGGATAAAC
ATTAAGTATGGTTCTGCTGAGTACAAGCCTGTCATCCTTATCGACTACCCCATACCTTCT
TATGAGAAGATTGCATACTATGCTGCATCTGATTGCTGTATTGTAAATGCTGTGAGGGAT
GGGATGAACTTGATACCATATGAGTATACTGTCTGCAGGCAGGGAAATGAGGAGATTGAT
AAGCTCAGAGGTGTTGATAAGAGCTCACATCACACAAGCACACTAATTGTGTCTGAGTTT
GTTGGTTGCTCCCCATCACTTAGTGGTGCTTTCAGGGTAAATCCTTGGAGTATTGAAGAT
GTAGCTGATGCATTATATAAAGCAATGGATTTGACTCAATCGGAGAGG

Protein

515 aa

>Os09t0376800-01 Similar to Trehalose-6-phosphate synthase (Fragment).
MVSKSYTNLLDMSGEDVFDFQQPFRSLPRFVTSPSITSNPDWDTSNADDSVGPASCCVRK
IIVSNFLPLNCTKDEATGQWSFSMDDNQLLVQLKDGFPMESEVVYVGSLNAEVDPGEQDQ
LSQKLFREYKCIPTFLPADLQQQFYHGFCKQQLWPLFHYMLPICLDKGELFDRSLFQAYV
RANKIFGDKVMEAINSDDDCVWVHDYHLMLLPTFLRKKLHRIKIGFFLHSPFPSSEIYRT
LPVRDEILKSLLNADLIGFQTFDYARHFLSCCSRLLGLNYESKRGHIGIEYFGRTVSLKI
LAVGVHVGRLESVLRLPATISKVQEIEQRYKGKMVMLGVDDMDIFKGISLKLLGLEFLLE
RTPKLRGKVVLVQIINPARSTGKDVEEAINEAVSVAERINIKYGSAEYKPVILIDYPIPS
YEKIAYYAASDCCIVNAVRDGMNLIPYEYTVCRQGNEEIDKLRGVDKSSHHTSTLIVSEF
VGCSPSLSGAFRVNPWSIEDVADALYKAMDLTQSER

5'UTR

chr09:12649802..12650074 (- strand) : 273 bp

chr09:12647552..12647562 (- strand) : 11 bp

CDS

chr09:12646004..12647551 (- strand) : 1548 bp

FASTA

>Os09t0376800-01 class=Sequence position=chr09:12646004..12650074 (- strand)
CGAGTCTTAC AAACATTTCT TCTCCTCTCT CTCTCTCTCT CTCTCTCAAC TCCACCACAT TTGTCTGTGT TCTTGCTGTC
TCTTCTTCTC CTACTTCCTC TACTCGATTC GAGGTTTGgc tgctgctgct gttgctgctg atagtggtgg tggtgggtgg
gagcagAAGC AGAAGCAGGA GGCAAAGAAA ATCTCGAGGA AGGAAGCAGA AGAAGCAGCC AAGAAACGCC GCCATCTCAT
CTGGATGCGC TGAATCTATC TGCCGCGGTG GAGGTGAGAA TCGGTCGCTC TCCTTATTGA TCCCCCTCCG TTTCTGCTCT
TGACTTGGTT TTCGCCTTGT TTGGAAAAAA AAAGGGTGTT TTTTTTGGGT GTCGAGATGG GGATTAGTGG AGGAAAGGAA
CGATCTTGGT CCTTTGGGGT TTTAGTTTTG ATCGATTTTA TGTTCTTCGC CGATTTTTTT TTTGTTCTTT TACGCCATTA
GTTTTGCCTG CAGGGGAATT GATGTGGTTT TAGGCGTTGG GTTGGGGGAT GAAATGTTGG TGTGCACTGA AAAGGGGGCT
TCTTTTTTTT TTCTTTTTTG CTACTGCTTT TTTTTTTTTA CCTGAGTGCA CTTAGTGCTT ATCATTTGCA TTTACGTGTA
GCAATTGGCA GTTATCTTAA CTGCAAGAGG GGGAAAAAAG GTAGCACAAA TCTTTTAGCC GTCATGCTAT TGCCATGTAG
TGGTATGAAC TGTTTGTGAT TTATATCACC CTTGTTATTT AACCCCAAGA AATGATCTGG ATGGTAGACT CATTCCAAAA
GAAATTATTC AAGGTGAGAT GATATAGGTA GTTCTGGGAC AACATCTCTG GGTAGCCCTT AAAGTTCATA TCATATCAAG
AGCATGAAGT TATAAGAGTA GTTCTTCTCA TCTGACTGAT GTGTGATATG GTGACGATTG AGTTTTTGCT TGTGGTCTCA
CAATTATGGG CAATTTTAGG GAAGTAGGCA GGTGATGTTG TCTCCGGGAC AATTTAATTT CCCGGATATA ATTCATGGCA
CATTGAATTC AATAATTCAA GTAGTACCTT CTTGTGGTAT GACCTTGGTC CAGTTAGGTG TGCTCTCAGG ATACAGCTCA
CAGCCACACC GAATGGTAGT ATTTTTTTTT ATtttttaga taatggaagc tttattgaac tcagtcaata gtatatcaGG
CATAGTTGTT GTCCTGTGAG AGACTGTAAT GGAGCATGCA AATAGAATGG ACTTTTGGAC AAACACTGAT CAAGTTAATG
ATAATGCCAG TTGCATTCAG GACAGTATTT CCGCTGTAGG ATGGATGCAA TTTGGATAGA TTAAGTTTCC TTTGGTCACG
TTGCTCGTCT TTGGTCTATG CTAATATGTT TTAGGATAGA TTTCACTGGG TAGGTATTGA AGTTTCTATA AGCTGGTTCC
ATTGACTTAA TTGCAAGTTC TGTATGCCAG GTAACACTGG TAGATACATT TTGGTATCAA AGGTAACATT ATACTATAGT
TATATGCCTA TATTTATGAT TGGCTAGAAC TTAGAAGGGG AAATGATTAG ATTGCATGTT GTTTGTGTCA TGCTAATGGA
AGGTGGTGGT CCTTGAATTC GTACTTTTGT GTTATTTTGG TAGGAGAGTG TGGTTCAATG TTCTTAAATG ATGTTTGGAG
TGGATATTTG TGGTCCTAAA CAAGAAGTAG ATGTGCTTCA TTTTGGATCT TTGGAGAGCT CATTGTCATG AAAAAAAAAA
TGAGATGTTT CCATTTACAG TGAAAGAACA GTTTACATGT CGGCACATCT TTTCCCCTGG AGCAAATAAG CCATTTGACA
CAATAAGTAA ATTGTGATTA GCAGTCTCTT TATTCTTTAT CACCTATACA TCCAGTGGAG AATTTTGTTC CATGTGCTCT
CTTGTGGGAA CTAATTTTAT TTTGGTGTTC AAACATAAAT TCCCTGAAAA TTGACTAGGC AGTTTTGTGA GCTTCCATGC
AACTATTGAG AATGGATAGC AGTTATGTAT AAAGTTAGTT TTTCAACTTA GATAAATTGA CCTGCACAAC TGGCAGTGTG
CTCTAGGCTC TAACATACTA CATAGATTTT TTTTTGAAAG GATACTACAT AGATTTTTTA TCCTTCAAAA TCCAAAATTC
GACTTAAAAA TACATCTTAA GAAGCTTTTA TGGTTATGTT TGCCTTGTAA CACTCAATGG TTCCAGCTTT GTTGTAATTA
GGATCCACCA TATTGAGGCT TGTTTTTAAA AAGGAATTCT TTTTTGGTCT CTGTTTTGAT AGTCTATATC ACGTGTCATA
GTTTTGTGAT ATATAATTAA TATTTTAGTT AACCAAATAA TTTACATAGA AATGAGCTTA CTAGTGTTTC TGCGTTCGAT
AAAATAACTA TGGCTTCATC ATAATATTTT TGTAATTTAA TGCCCCTGCT AGAACATGTA TTTATTTCAA AGGACTAAAA
TGTATTCTTT GATGTTTTCT TTGTTGCAAA AGGTTGTGGA ATCATGGTTT CAAAGTCATA TACAAATCTT CTAGATATGA
GTGGTGAAGA TGTGTTTGAC TTTCAGCAAC CATTTAGATC GCTTCCTCGT TTTGTGACTT CCCCAAGCAT CACATCTAAT
CCTGATTGGG ATACAAGTAA TGCTGATGAT TCAGTTGGTC CTGCATCTTG CTGTGTAAGG AAAATAATCG TCTCCAACTT
TCTTCCACTA AACTGTACCA AAGATGAAGC TACTGGACAG TGGTCCTTCT CAATGGATGA CAATCAACTT CTTGTTCAAC
TTAAAGATGG ATTTCCAATG GAGAGCGAAG TTGTTTATGT GGGTAGCTTG AACGCTGAAG TTGATCCTGG TGAGCAAGAT
CAACTTTCAC AGAAACTTTT CAGAGAATAC AAATGCATAC CTACTTTCCT CCCAGCTGAC CTCCAGCAGC AGTTCTATCA
TGGATTCTGT AAACAACAAT TATGGCCACT TTTCCATTAT ATGCTTCCTA TTTGCCTCGA CAAAGGCGAG CTCTTTGACC
GCTCTCTATT TCAAGCCTAT GTTCGGGCAA ACAAAATATT TGGTGACAAA GTTATGGAGG CCATCAATTC AGATGATGAC
TGTGTGTGGG TTCATGATTA TCACCTCATG CTTCTCCCAA CCTTTTTAAG AAAAAAGCTT CATCGCATCA AAATTGGTTT
CTTCCTTCAC AGTCCATTTC CCTCCTCTGA AATCTATAGG ACACTGCCAG TAAGAGATGA AATTTTGAAG TCTCTTCTGA
ATGCTGATCT CATTGGCTTT CAAACATTTG ACTATGCCCG CCACTTCCTT TCATGTTGCA GCAGATTGTT AGGCCTTAAT
TACGAGTCAA AACGTGGTCA CATCGGTATA GAGTACTTTG GCCGTACGGT GAGCCTCAAG ATCCTTGCTG TGGGTGTACA
TGTTGGTCGT CTTGAGTCTG TGTTGAGGCT GCCTGCCACA ATTAGCAAGG TTCAAGAAAT TGAGCAAAGA TATAAGGGTA
AGATGGTGAT GTTGGGTGTA GATGATATGG ATATCTTCAA AGGGATCAGT CTAAAATTGC TTGGCTTGGA ATTTCTTTTG
GAGAGAACTC CAAAGCTAAG AGGGAAGGTT GTCCTTGTGC AGATTATAAA TCCTGCAAGA AGCACTGGAA AAGATGTGGA
GGAAGCAATA AATGAAGCCG TCTCTGTAGC TGAAAGGATA AACATTAAGT ATGGTTCTGC TGAGTACAAG CCTGTCATCC
TTATCGACTA CCCCATACCT TCTTATGAGA AGATTGCATA CTATGCTGCA TCTGATTGCT GTATTGTAAA TGCTGTGAGG
GATGGGATGA ACTTGATACC ATATGAGTAT ACTGTCTGCA GGCAGGGAAA TGAGGAGATT GATAAGCTCA GAGGTGTTGA
TAAGAGCTCA CATCACACAA GCACACTAAT TGTGTCTGAG TTTGTTGGTT GCTCCCCATC ACTTAGTGGT GCTTTCAGGG
TAAATCCTTG GAGTATTGAA GATGTAGCTG ATGCATTATA TAAAGCAATG GATTTGACTC AATCGGAGAG G

Locus: Os09g0376800

Loading...

Locus: Os09g0376800

Loading...