Os09t0399800-01

Locus

Os09g0399800

Description

Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD8A

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 8A

Oryzabase Gene Symbol Synonym(s)

OsCAD8A

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 8A

Transcript Evidence

AK059858 (DDBJ, Best hit)

Protein Evidence

Q8S412 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Full-length cDNA

006-207-B03 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0399800-01)

RiceXPro (AK059858)

Others

Oryzabase (10436)

KEGG (Os09t0399800-01 (EC:1.1.1.195))

Transcript

1407 bp

>Os09t0399800-01 Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
CTATTTAATCCTGTATCACGCCCAGATTCCTGAGTCCAAAACCAACTACTGATAGTCTAA
TAGTATCGATCACTGAGGAAGAAGAGCATAGCAAAAGAGTGGTCGATCGTCATCAATGGA
GCACGACGGCACGGCGGCGCTCGGCTGGGCGGCGCGGGACGCCTCCGGCCACCTCTCACC
GTTCAGCTTCACAAGAAGGGTTCAGGAGGAAGACGACGTGACGATCAAGGTGCTCTACTG
CGGCATCTGTCACACCGACCTGCACACCATCAAGAACGAGTGGGGCAACGCCATGTACCC
CGTCGTCCCCGGCCACGAGATCGTCGGCGTCGTCGCCGGCGTCGGCGCCGGCGTGACCAG
GTTCAAGGCCGGCGACACGGTGGGCGTGGGCTACTTCGTCGACTCGTGCCGCGCCTGCGA
CAGCTGCGGCAAGGGGGACGAGAACTACTGCCCGACGATGGTGATCACGTCGAACGGCAC
GGACTACGGCGGCGCCACCACCCAGGGCGGTTTCTCCGACGTCATGGTCGTGAGGCAGGA
CTACGTGTTGCGCGTCCCGGCGAGCCTGCCGCCGGACGGCGCGGCGCCGCTGCTGTGCGC
CGGCGTGACGGTGTACAGTCCGATGGTGGAGTACGGCCTGAACGCCCCCGGGAAGCACCT
CGGCGTGGTCGGCCTCGGCGGGCTGGGCCACCTGGGCGTCAAGTTCGGCAAGGCGTTCGG
GATGAAGGTGACGGTGATCAGCTCGTCGCCGGCGAAGCGGGAGGAGGCGCTGGAGCGGCT
CGGCGCCGACGCGTTCCTGTCGAGCCGCGACGGCGAGGGGATGGCGGCGGCGGCGGCGAC
GATGGACGGGATCATCGACACGGTGTCCGCGGGGCACCCGCTGGTGCCGCTGCTGTCGCT
GCTGAAGCCCAAGGGGCAGATGGTGGTGGTGGGCGCGCCGGCGGCGCCGCTGCAGCTGCC
CGCGATCGCCATCATCGATGGCGGGAAGCGCGTCGCCGGGAGCGGCGGGGGCAGCGTGGC
CGAGTGCCAGGCGATGCTGGACTTCGCCGGCGAGCACGGCATCGCCGCGGACGTCGAGGT
GGTCGCCATGGGCGACGTCAACGCCGCCCTCGGCCGCCTCGAGAGGAACGACGTGAGGTA
CCGCTTCGTCATCGACGTCGCCGGCACCCTGCACGCCGCCGCCGCGCCGTCCTAGGCTCC
TAGCAATGTTGCCTTCGTGTCAACGTGCTTGCGTGTCATTGTGCGGTCGTGTGTGTAACC
GTGAAAGGAGAGGCGTTTGGTAATGGAGCAATAACGTTGTTTTTGGACCGTGATGGTCCG
TGGGCTTGTGATGGGTTATGTGGGCCACCTCGAGTTGGGCCCTTCTCTTGTCCGATTCTT
TGTCCAAAGATTGAaataagttcatct

CDS

1080 bp

>Os09t0399800-01 Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
ATGGAGCACGACGGCACGGCGGCGCTCGGCTGGGCGGCGCGGGACGCCTCCGGCCACCTC
TCACCGTTCAGCTTCACAAGAAGGGTTCAGGAGGAAGACGACGTGACGATCAAGGTGCTC
TACTGCGGCATCTGTCACACCGACCTGCACACCATCAAGAACGAGTGGGGCAACGCCATG
TACCCCGTCGTCCCCGGCCACGAGATCGTCGGCGTCGTCGCCGGCGTCGGCGCCGGCGTG
ACCAGGTTCAAGGCCGGCGACACGGTGGGCGTGGGCTACTTCGTCGACTCGTGCCGCGCC
TGCGACAGCTGCGGCAAGGGGGACGAGAACTACTGCCCGACGATGGTGATCACGTCGAAC
GGCACGGACTACGGCGGCGCCACCACCCAGGGCGGTTTCTCCGACGTCATGGTCGTGAGG
CAGGACTACGTGTTGCGCGTCCCGGCGAGCCTGCCGCCGGACGGCGCGGCGCCGCTGCTG
TGCGCCGGCGTGACGGTGTACAGTCCGATGGTGGAGTACGGCCTGAACGCCCCCGGGAAG
CACCTCGGCGTGGTCGGCCTCGGCGGGCTGGGCCACCTGGGCGTCAAGTTCGGCAAGGCG
TTCGGGATGAAGGTGACGGTGATCAGCTCGTCGCCGGCGAAGCGGGAGGAGGCGCTGGAG
CGGCTCGGCGCCGACGCGTTCCTGTCGAGCCGCGACGGCGAGGGGATGGCGGCGGCGGCG
GCGACGATGGACGGGATCATCGACACGGTGTCCGCGGGGCACCCGCTGGTGCCGCTGCTG
TCGCTGCTGAAGCCCAAGGGGCAGATGGTGGTGGTGGGCGCGCCGGCGGCGCCGCTGCAG
CTGCCCGCGATCGCCATCATCGATGGCGGGAAGCGCGTCGCCGGGAGCGGCGGGGGCAGC
GTGGCCGAGTGCCAGGCGATGCTGGACTTCGCCGGCGAGCACGGCATCGCCGCGGACGTC
GAGGTGGTCGCCATGGGCGACGTCAACGCCGCCCTCGGCCGCCTCGAGAGGAACGACGTG
AGGTACCGCTTCGTCATCGACGTCGCCGGCACCCTGCACGCCGCCGCCGCGCCGTCCTAG

Protein

360 aa

>Os09t0399800-01 Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
MEHDGTAALGWAARDASGHLSPFSFTRRVQEEDDVTIKVLYCGICHTDLHTIKNEWGNAM
YPVVPGHEIVGVVAGVGAGVTRFKAGDTVGVGYFVDSCRACDSCGKGDENYCPTMVITSN
GTDYGGATTQGGFSDVMVVRQDYVLRVPASLPPDGAAPLLCAGVTVYSPMVEYGLNAPGK
HLGVVGLGGLGHLGVKFGKAFGMKVTVISSSPAKREEALERLGADAFLSSRDGEGMAAAA
ATMDGIIDTVSAGHPLVPLLSLLKPKGQMVVVGAPAAPLQLPAIAIIDGGKRVAGSGGGS
VAECQAMLDFAGEHGIAADVEVVAMGDVNAALGRLERNDVRYRFVIDVAGTLHAAAAPS*

5'UTR

chr09:13984470..13984584 (- strand) : 115 bp

CDS

chr09:13984387..13984469 (- strand) : 83 bp

chr09:13983193..13984189 (- strand) : 997 bp

3'UTR

chr09:13982981..13983192 (- strand) : 212 bp

FASTA

>Os09t0399800-01 class=Sequence position=chr09:13982981..13984584 (- strand)
CTATTTAATC CTGTATCACG CCCAGATTCC TGAGTCCAAA ACCAACTACT GATAGTCTAA TAGTATCGAT CACTGAGGAA
GAAGAGCATA GCAAAAGAGT GGTCGATCGT CATCAATGGA GCACGACGGC ACGGCGGCGC TCGGCTGGGC GGCGCGGGAC
GCCTCCGGCC ACCTCTCACC GTTCAGCTTC ACAAGAAGGT CATAATTAAC TACTACTTCC TCCGTCCTAA AATGTTGTTA
ACTAGGATTT GTCTAGATTT GTTGTCTTAG GAATCCCATC ATAGATAGCA ACATTTTAGG ATGGAAGTAG TATATATCTC
TGTCTTGTGC TCACCGTCGT CGTTTCGATC TGCCATGGGC ATCACTGAAC TTTGCGACGG TGATGTGTGG TGCAGGGTTC
AGGAGGAAGA CGACGTGACG ATCAAGGTGC TCTACTGCGG CATCTGTCAC ACCGACCTGC ACACCATCAA GAACGAGTGG
GGCAACGCCA TGTACCCCGT CGTCCCCGGC CACGAGATCG TCGGCGTCGT CGCCGGCGTC GGCGCCGGCG TGACCAGGTT
CAAGGCCGGC GACACGGTGG GCGTGGGCTA CTTCGTCGAC TCGTGCCGCG CCTGCGACAG CTGCGGCAAG GGGGACGAGA
ACTACTGCCC GACGATGGTG ATCACGTCGA ACGGCACGGA CTACGGCGGC GCCACCACCC AGGGCGGTTT CTCCGACGTC
ATGGTCGTGA GGCAGGACTA CGTGTTGCGC GTCCCGGCGA GCCTGCCGCC GGACGGCGCG GCGCCGCTGC TGTGCGCCGG
CGTGACGGTG TACAGTCCGA TGGTGGAGTA CGGCCTGAAC GCCCCCGGGA AGCACCTCGG CGTGGTCGGC CTCGGCGGGC
TGGGCCACCT GGGCGTCAAG TTCGGCAAGG CGTTCGGGAT GAAGGTGACG GTGATCAGCT CGTCGCCGGC GAAGCGGGAG
GAGGCGCTGG AGCGGCTCGG CGCCGACGCG TTCCTGTCGA GCCGCGACGG CGAGGGGATG GCGGCGGCGG CGGCGACGAT
GGACGGGATC ATCGACACGG TGTCCGCGGG GCACCCGCTG GTGCCGCTGC TGTCGCTGCT GAAGCCCAAG GGGCAGATGG
TGGTGGTGGG CGCGCCGGCG GCGCCGCTGC AGCTGCCCGC GATCGCCATC ATCGATGGCG GGAAGCGCGT CGCCGGGAGC
GGCGGGGGCA GCGTGGCCGA GTGCCAGGCG ATGCTGGACT TCGCCGGCGA GCACGGCATC GCCGCGGACG TCGAGGTGGT
CGCCATGGGC GACGTCAACG CCGCCCTCGG CCGCCTCGAG AGGAACGACG TGAGGTACCG CTTCGTCATC GACGTCGCCG
GCACCCTGCA CGCCGCCGCC GCGCCGTCCT AGGCTCCTAG CAATGTTGCC TTCGTGTCAA CGTGCTTGCG TGTCATTGTG
CGGTCGTGTG TGTAACCGTG AAAGGAGAGG CGTTTGGTAA TGGAGCAATA ACGTTGTTTT TGGACCGTGA TGGTCCGTGG
GCTTGTGATG GGTTATGTGG GCCACCTCGA GTTGGGCCCT TCTCTTGTCC GATTCTTTGT CCAAAGATTG Aaataagttc
atct

Locus: Os09g0399800

Loading...

Locus: Os09g0399800

Loading...