Os09t0400000-00

Locus

Os09g0400000

Description

Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD8B

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 8B

Oryzabase Gene Symbol Synonym(s)

OsCAD8B

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 8B

Transcript Evidence

Q6ERW9 (UniProt)

Protein Evidence

Q6ERW9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Expression Databases

TENOR (Os09t0400000-00)

Others

Oryzabase (10437)

Transcript

1311 bp

>Os09t0400000-00 Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
ATGTCACGTCATTTTCGCACGCACACCACCTCGCGTCTCACCTTCCCCTCTTCCTCCGGT
GGACTCGCAATCACTCGCTTGCCATTCTCCAGCACCAGCAGCAAGCTTCTTCTTCAGCAA
CTCAGCAGCACTTCACCTGCTGCTGCTGCGACCGCCGTGACCATCACCACCTCGTCGCCG
GCGAGAAACCTGCAGAGGGCGAGGGCGAGTGCGGCGGAGCAGGGGATGGAGGAGCATGGC
AAGGCGGCTGTCGGCTGGGCGGCCAGGGACGACTCCGGCGTCCTCTCCCCGTACAACTTC
TCCAGGAGGGCTCAGAAGGACGATGACGTCACCATCAAGGTGCTCTACTGCGGCATCTGC
CACACCGACCTGCACGTCGTCAAGAACGATTGGGGCAACGCCATGTACCCCGTCGTCCCC
GGCCACGAGATCGTCGGCGTCGTCACCGGCGTCGGCGCCGGCGTGACCAAGTTCAAGGCC
GGCGACACGGTGGGCGTGGGCTTCTTCGTCGGGTCGTGCCGCACCTGCGACAGCTGCGGC
AAGGGGTACGAGAACTACTGCCCGACGATGGTGATCACGTCGAACGGCAAGGACTACGGC
GGCGCGGCCACCCAGGGCGGCTTCTCCGACGCCATCGTCGTGAACGAACACTACGTGCTC
CGCGTGCCGGCGGGGCTGCCGCTGGACGGCGCGGCGCCGCTGCTGTGCGCCGGCGTGACG
GTGTACAGCCCGATGGTGATCCACGGGCTGAACGCGCCGGGGAAGCACGTCGGCGTGGTC
GGCCTCGGCGGGCTCGGCCACGTCGCCGTCAAGTTCGCCAAGGCGTTCGGGATGCGCGTC
ACCGTCATCAGCACGTCGCCGGGGAAGCGGCGGGAGGCGCTGGAGCACCTCGGCGCCGAC
GAGTTCCTCGTCAGCCGCGACGCGGGCCAGATGGCGGCGGCGGCGGGCACCATGGACGGG
ATCCTCAACACGGTGTCGGCGTGGCACCCGGTCGCGCCGCTGTTCGCACTGATGAAGCCG
ATGGCGCAGATGGTGTTCGTCGGCGCGCCGACCAGGCCGCTGGAGCTGCCGGCGTACGCC
ATCGTCCCGGGAGGGAAGGGCATCACCGGCAACTGCGTCGGCGGCATCAGGGACTGCCAG
GCCATGCTCGACTTCGCCGGCGAGCACGGAATCACCGCCGAGGTGGAGGTGATCAAGATG
GACTACGTCAACACCGCGATGGAGCGGCTGGAGAAGAACGACGTCCGCTACCGCTTCGTC
ATCGACGTCGCCGGCAGCAGCCTCGGCGGCTCCGGCGACGACAAGATATAA

CDS

1311 bp

>Os09t0400000-00 Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
ATGTCACGTCATTTTCGCACGCACACCACCTCGCGTCTCACCTTCCCCTCTTCCTCCGGT
GGACTCGCAATCACTCGCTTGCCATTCTCCAGCACCAGCAGCAAGCTTCTTCTTCAGCAA
CTCAGCAGCACTTCACCTGCTGCTGCTGCGACCGCCGTGACCATCACCACCTCGTCGCCG
GCGAGAAACCTGCAGAGGGCGAGGGCGAGTGCGGCGGAGCAGGGGATGGAGGAGCATGGC
AAGGCGGCTGTCGGCTGGGCGGCCAGGGACGACTCCGGCGTCCTCTCCCCGTACAACTTC
TCCAGGAGGGCTCAGAAGGACGATGACGTCACCATCAAGGTGCTCTACTGCGGCATCTGC
CACACCGACCTGCACGTCGTCAAGAACGATTGGGGCAACGCCATGTACCCCGTCGTCCCC
GGCCACGAGATCGTCGGCGTCGTCACCGGCGTCGGCGCCGGCGTGACCAAGTTCAAGGCC
GGCGACACGGTGGGCGTGGGCTTCTTCGTCGGGTCGTGCCGCACCTGCGACAGCTGCGGC
AAGGGGTACGAGAACTACTGCCCGACGATGGTGATCACGTCGAACGGCAAGGACTACGGC
GGCGCGGCCACCCAGGGCGGCTTCTCCGACGCCATCGTCGTGAACGAACACTACGTGCTC
CGCGTGCCGGCGGGGCTGCCGCTGGACGGCGCGGCGCCGCTGCTGTGCGCCGGCGTGACG
GTGTACAGCCCGATGGTGATCCACGGGCTGAACGCGCCGGGGAAGCACGTCGGCGTGGTC
GGCCTCGGCGGGCTCGGCCACGTCGCCGTCAAGTTCGCCAAGGCGTTCGGGATGCGCGTC
ACCGTCATCAGCACGTCGCCGGGGAAGCGGCGGGAGGCGCTGGAGCACCTCGGCGCCGAC
GAGTTCCTCGTCAGCCGCGACGCGGGCCAGATGGCGGCGGCGGCGGGCACCATGGACGGG
ATCCTCAACACGGTGTCGGCGTGGCACCCGGTCGCGCCGCTGTTCGCACTGATGAAGCCG
ATGGCGCAGATGGTGTTCGTCGGCGCGCCGACCAGGCCGCTGGAGCTGCCGGCGTACGCC
ATCGTCCCGGGAGGGAAGGGCATCACCGGCAACTGCGTCGGCGGCATCAGGGACTGCCAG
GCCATGCTCGACTTCGCCGGCGAGCACGGAATCACCGCCGAGGTGGAGGTGATCAAGATG
GACTACGTCAACACCGCGATGGAGCGGCTGGAGAAGAACGACGTCCGCTACCGCTTCGTC
ATCGACGTCGCCGGCAGCAGCCTCGGCGGCTCCGGCGACGACAAGATATAA

Protein

437 aa

>Os09t0400000-00 Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
MSRHFRTHTTSRLTFPSSSGGLAITRLPFSSTSSKLLLQQLSSTSPAAAATAVTITTSSP
ARNLQRARASAAEQGMEEHGKAAVGWAARDDSGVLSPYNFSRRAQKDDDVTIKVLYCGIC
HTDLHVVKNDWGNAMYPVVPGHEIVGVVTGVGAGVTKFKAGDTVGVGFFVGSCRTCDSCG
KGYENYCPTMVITSNGKDYGGAATQGGFSDAIVVNEHYVLRVPAGLPLDGAAPLLCAGVT
VYSPMVIHGLNAPGKHVGVVGLGGLGHVAVKFAKAFGMRVTVISTSPGKRREALEHLGAD
EFLVSRDAGQMAAAAGTMDGILNTVSAWHPVAPLFALMKPMAQMVFVGAPTRPLELPAYA
IVPGGKGITGNCVGGIRDCQAMLDFAGEHGITAEVEVIKMDYVNTAMERLEKNDVRYRFV
IDVAGSSLGGSGDDKI*

CDS

chr09:13988472..13988779 (- strand) : 308 bp

chr09:13987065..13988067 (- strand) : 1003 bp

FASTA

>Os09t0400000-00 class=Sequence position=chr09:13987065..13988779 (- strand)
ATGTCACGTC ATTTTCGCAC GCACACCACC TCGCGTCTCA CCTTCCCCTC TTCCTCCGGT GGACTCGCAA TCACTCGCTT
GCCATTCTCC AGCACCAGCA GCAAGCTTCT TCTTCAGCAA CTCAGCAGCA CTTCACCTGC TGCTGCTGCG ACCGCCGTGA
CCATCACCAC CTCGTCGCCG GCGAGAAACC TGCAGAGGGC GAGGGCGAGT GCGGCGGAGC AGGGGATGGA GGAGCATGGC
AAGGCGGCTG TCGGCTGGGC GGCCAGGGAC GACTCCGGCG TCCTCTCCCC GTACAACTTC TCCAGGAGGT CAGTGAGAAA
ATTTTTACCG TGATTTTGTA GTTGGAGAAG ATGCCTTTTC TCTCTGTTTC TGTGTGGATG AGTTGTTTAA AGATTCAGAT
CCTATAGGCT ATAGCTAGGA GAATGGATAG ATCAAGATAG TTTAGCTGTC AGATCAGTAC AAGTGTCAGT TAGAAATCAG
CAGTCAAAGA AGTCAAGAAC AAGAGCCGAT TCTTTATTTT ACATTATCTG AAAGTTTTAG ATGGTTTTTC ACTTGATCTA
TGGACTTTTG ATTAATTTGG CAGTAAATTA TATTCTATAA TCTGGAGTAG TGTTCAATTT GCTACTGTAT GAGGCTATGA
ACTGTCACTT TTAAGGCTAA TCTGTCTGAT GGATAATCTT ATCAGCTGCT GCTGCTGACA AAAACATTTC AGGGCTCAGA
AGGACGATGA CGTCACCATC AAGGTGCTCT ACTGCGGCAT CTGCCACACC GACCTGCACG TCGTCAAGAA CGATTGGGGC
AACGCCATGT ACCCCGTCGT CCCCGGCCAC GAGATCGTCG GCGTCGTCAC CGGCGTCGGC GCCGGCGTGA CCAAGTTCAA
GGCCGGCGAC ACGGTGGGCG TGGGCTTCTT CGTCGGGTCG TGCCGCACCT GCGACAGCTG CGGCAAGGGG TACGAGAACT
ACTGCCCGAC GATGGTGATC ACGTCGAACG GCAAGGACTA CGGCGGCGCG GCCACCCAGG GCGGCTTCTC CGACGCCATC
GTCGTGAACG AACACTACGT GCTCCGCGTG CCGGCGGGGC TGCCGCTGGA CGGCGCGGCG CCGCTGCTGT GCGCCGGCGT
GACGGTGTAC AGCCCGATGG TGATCCACGG GCTGAACGCG CCGGGGAAGC ACGTCGGCGT GGTCGGCCTC GGCGGGCTCG
GCCACGTCGC CGTCAAGTTC GCCAAGGCGT TCGGGATGCG CGTCACCGTC ATCAGCACGT CGCCGGGGAA GCGGCGGGAG
GCGCTGGAGC ACCTCGGCGC CGACGAGTTC CTCGTCAGCC GCGACGCGGG CCAGATGGCG GCGGCGGCGG GCACCATGGA
CGGGATCCTC AACACGGTGT CGGCGTGGCA CCCGGTCGCG CCGCTGTTCG CACTGATGAA GCCGATGGCG CAGATGGTGT
TCGTCGGCGC GCCGACCAGG CCGCTGGAGC TGCCGGCGTA CGCCATCGTC CCGGGAGGGA AGGGCATCAC CGGCAACTGC
GTCGGCGGCA TCAGGGACTG CCAGGCCATG CTCGACTTCG CCGGCGAGCA CGGAATCACC GCCGAGGTGG AGGTGATCAA
GATGGACTAC GTCAACACCG CGATGGAGCG GCTGGAGAAG AACGACGTCC GCTACCGCTT CGTCATCGAC GTCGCCGGCA
GCAGCCTCGG CGGCTCCGGC GACGACAAGA TATAA

Locus: Os09g0400000

Loading...

Locus: Os09g0400000

Loading...