Os09t0400300-01

Locus

Os09g0400300

Description

Similar to Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CAD8C

CGSNL Gene Name

CINNAMYL ALCOHOL DEHYDROGENASE 8C

Oryzabase Gene Symbol Synonym(s)

OsCAD8C, CAD8c

Oryzabase Gene Name Synonym(s)

Cinnamyl alcohol dehydrogenase 8C

Transcript Evidence

AK067085 (DDBJ, Best hit)

Protein Evidence

Q2HZE4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Alcohol dehydrogenase superfamily, zinc-type (IPR002085)

Alcohol dehydrogenase, zinc-type, conserved site (IPR002328)

GroES-like (IPR011032)

Alcohol dehydrogenase, C-terminal (IPR013149)

Alcohol dehydrogenase GroES-like (IPR013154)

NAD(P)-binding domain (IPR016040)

Polyketide synthase, enoylreductase (IPR020843)

Full-length cDNA

J013096I15 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0400300-01)

RiceXPro (AK067085)

Others

Oryzabase (10438)

KEGG (Os09t0400300-01 (EC:1.1.1.195))

Transcript

1912 bp

>Os09t0400300-01 Similar to Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
ACTCGCTTGCCATTCTCCAGCACCAGCAGCAAGCTTCTTCTTCAGCAACTCAGCAGCACT
TCACCTGCTGCTGCTGCGACCGCCGTGACCATCACCACCTCGTCGCCGGCGAGAAACCTG
CAGAGGGCGAGGGCGAGTGCGGCGGAGCAGGGGATGGAGGAGCATGGCAAGGCGGCTGTC
GGCTGGGCGGCCAGGGACGACTCCGGCGTCCTCTCCCCGTACAACTTCTCCAGGAGGTCA
GTGAGCTTCTGAGCTCTGTCACTGAGAACTCTCACCGTTTTGTTTGTTCTCGTGTGAGAA
TTTTCGCCATGATTTTTGGAGTTGGAGAAGATGCCTTGTCTCTCTGTTTCTGTGTGGATG
AGTTGTTTCAAGATTCAGATCCTATAGCTAGGAGAATGGATAGATCGAGATAGTTTAGCT
GTCAGATCAATACAAGTGTCAGTCAGTTAAAAATCAGCAGTCAAACAAGTCAAGAACCAG
AGCCGATTCTTTATTTTACATTATCTGAAAGTTTTAATAGTCTTTCACTTGATCTATGCA
CTTTTTGATTAATTTGGCAGTAAATTATATTCTATAATCTGGAGTAGTGTTCAATTTGCT
ACTGTATGAGGCTATGAACTGTCACTTTTGCGGCTAATCTGTCTAGTGGATAATCTTATC
TGCTTCTGCTGACTAAAAAAAATTTCAGGGCTCAGAAGGACGATGACGTCACCATCAAGG
TGCTCTACTGCGGCATCTGCCACACTGACCTGCACATCGTCAAGAATGATTGGGGCAACG
CCATGTACCCCGTCGTCCCCGGCCACGAGATCGTCGGCGTCGTCACCGGCGTCGGCGCCG
GCGTGACCAAGTTCAAGGCCGGCGACACGGTGGGCGTGGGCTACTTCGTCGCGTCGTGCC
GCGGCTGCGAGTGCTGCGGGAATGGGTACGAGAACTACTGCGCCAAGATGGTAACCACCT
GCAACGGCGTCGACCACGACCACGGCGGCGGCGCGGCCACCCAGGGCGGCTTCTCCGACG
CCATCGTCGTCAACGAGCACTACGTGCTCCGCGTGCCGGCGGGGCTGCCGCTGGACAGCG
CGGCGCCGCTGCTGTGCGCCGGCGTGACGGTGTACAGCCCGATGGTGATCCACGGCCTGA
ACGCGCCGGGGAAGCACGTCGGCGTCGTCGGCCTCGGCGGGCTCGGCCACGTCGCCGTCA
AGTTCGCCAAGGCGTTCGGGATGCGCGTCACCGTCATCAGCACGTCGCCGGGGAAGCGGC
AGGAGGCACTGGAGCACCTCGGCGCCGACGAGTTCCTCGTCAGCCGCGACGCGGGCCAGA
TGGCGGCGGCGGCGGCCACCATGGACGGGATCCTCAACACGGTGTCGGCCTGGCACCCGA
TCGCGCCGCTGTTCTCGCTGATGAAGCCGATGGCGCAGATGGTGTTCGTCGGCGGGCCGA
CCAGGCCGCTGGAGCTGCCGGCGTACGCCATCGTGCCCGGAGGGAAGGGCATCACCGGCA
ACTGCGTCGGCGGCATCAGGGACTGCCAGGCCATGCTCGACTTCGCCGGCGAGCACGGCA
TCACTGCCGAGGTGGAGGTCATCAAGATGGACTACGTCAACACGGCGATGGAGCGGCTGG
AGAAGAACGATGTCCGCTACCGCTTCGTCATCGACGTTGCCGGCAGCAGCCTCGCCGGCT
CCGGCGACGCCAAGATATAAAGCTCGCCGGCTTGCTTGCTTGCTTGTGTCGACGGCGCCG
GCGCCGCCTAGCTTGCTTGTTGTGTGTCAGTGGCCTTGAATGTTTGGTGATGTGCAAACT
ACTACGAAATGGAGTAAGAAATAAGTGGAGCATATGTCTCCATCACTTGGTTATTAATTA
GTCGAGCTAATTAATTGTACATATTGAGAAATGATGATAGGCCACATTGTTT

CDS

1047 bp

>Os09t0400300-01 Similar to Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
TCTTATCTGCTTCTGCTGACTAAAAAAAATTTCAGGGCTCAGAAGGACGATGACGTCACC
ATCAAGGTGCTCTACTGCGGCATCTGCCACACTGACCTGCACATCGTCAAGAATGATTGG
GGCAACGCCATGTACCCCGTCGTCCCCGGCCACGAGATCGTCGGCGTCGTCACCGGCGTC
GGCGCCGGCGTGACCAAGTTCAAGGCCGGCGACACGGTGGGCGTGGGCTACTTCGTCGCG
TCGTGCCGCGGCTGCGAGTGCTGCGGGAATGGGTACGAGAACTACTGCGCCAAGATGGTA
ACCACCTGCAACGGCGTCGACCACGACCACGGCGGCGGCGCGGCCACCCAGGGCGGCTTC
TCCGACGCCATCGTCGTCAACGAGCACTACGTGCTCCGCGTGCCGGCGGGGCTGCCGCTG
GACAGCGCGGCGCCGCTGCTGTGCGCCGGCGTGACGGTGTACAGCCCGATGGTGATCCAC
GGCCTGAACGCGCCGGGGAAGCACGTCGGCGTCGTCGGCCTCGGCGGGCTCGGCCACGTC
GCCGTCAAGTTCGCCAAGGCGTTCGGGATGCGCGTCACCGTCATCAGCACGTCGCCGGGG
AAGCGGCAGGAGGCACTGGAGCACCTCGGCGCCGACGAGTTCCTCGTCAGCCGCGACGCG
GGCCAGATGGCGGCGGCGGCGGCCACCATGGACGGGATCCTCAACACGGTGTCGGCCTGG
CACCCGATCGCGCCGCTGTTCTCGCTGATGAAGCCGATGGCGCAGATGGTGTTCGTCGGC
GGGCCGACCAGGCCGCTGGAGCTGCCGGCGTACGCCATCGTGCCCGGAGGGAAGGGCATC
ACCGGCAACTGCGTCGGCGGCATCAGGGACTGCCAGGCCATGCTCGACTTCGCCGGCGAG
CACGGCATCACTGCCGAGGTGGAGGTCATCAAGATGGACTACGTCAACACGGCGATGGAG
CGGCTGGAGAAGAACGATGTCCGCTACCGCTTCGTCATCGACGTTGCCGGCAGCAGCCTC
GCCGGCTCCGGCGACGCCAAGATATAA

Protein

349 aa

>Os09t0400300-01 Similar to Cinnamyl alcohol dehydrogenase (EC 1.1.1.195).
SYLLLLTKKNFRAQKDDDVTIKVLYCGICHTDLHIVKNDWGNAMYPVVPGHEIVGVVTGV
GAGVTKFKAGDTVGVGYFVASCRGCECCGNGYENYCAKMVTTCNGVDHDHGGGAATQGGF
SDAIVVNEHYVLRVPAGLPLDSAAPLLCAGVTVYSPMVIHGLNAPGKHVGVVGLGGLGHV
AVKFAKAFGMRVTVISTSPGKRQEALEHLGADEFLVSRDAGQMAAAAATMDGILNTVSAW
HPIAPLFSLMKPMAQMVFVGGPTRPLELPAYAIVPGGKGITGNCVGGIRDCQAMLDFAGE
HGITAEVEVIKMDYVNTAMERLEKNDVRYRFVIDVAGSSLAGSGDAKI*

5'UTR

chr09:13994666..13995318 (+ strand) : 653 bp

CDS

chr09:13995319..13996365 (+ strand) : 1047 bp

3'UTR

chr09:13996366..13996577 (+ strand) : 212 bp

FASTA

>Os09t0400300-01 class=Sequence position=chr09:13994666..13996577 (+ strand)
ACTCGCTTGC CATTCTCCAG CACCAGCAGC AAGCTTCTTC TTCAGCAACT CAGCAGCACT TCACCTGCTG CTGCTGCGAC
CGCCGTGACC ATCACCACCT CGTCGCCGGC GAGAAACCTG CAGAGGGCGA GGGCGAGTGC GGCGGAGCAG GGGATGGAGG
AGCATGGCAA GGCGGCTGTC GGCTGGGCGG CCAGGGACGA CTCCGGCGTC CTCTCCCCGT ACAACTTCTC CAGGAGGTCA
GTGAGCTTCT GAGCTCTGTC ACTGAGAACT CTCACCGTTT TGTTTGTTCT CGTGTGAGAA TTTTCGCCAT GATTTTTGGA
GTTGGAGAAG ATGCCTTGTC TCTCTGTTTC TGTGTGGATG AGTTGTTTCA AGATTCAGAT CCTATAGCTA GGAGAATGGA
TAGATCGAGA TAGTTTAGCT GTCAGATCAA TACAAGTGTC AGTCAGTTAA AAATCAGCAG TCAAACAAGT CAAGAACCAG
AGCCGATTCT TTATTTTACA TTATCTGAAA GTTTTAATAG TCTTTCACTT GATCTATGCA CTTTTTGATT AATTTGGCAG
TAAATTATAT TCTATAATCT GGAGTAGTGT TCAATTTGCT ACTGTATGAG GCTATGAACT GTCACTTTTG CGGCTAATCT
GTCTAGTGGA TAATCTTATC TGCTTCTGCT GACTAAAAAA AATTTCAGGG CTCAGAAGGA CGATGACGTC ACCATCAAGG
TGCTCTACTG CGGCATCTGC CACACTGACC TGCACATCGT CAAGAATGAT TGGGGCAACG CCATGTACCC CGTCGTCCCC
GGCCACGAGA TCGTCGGCGT CGTCACCGGC GTCGGCGCCG GCGTGACCAA GTTCAAGGCC GGCGACACGG TGGGCGTGGG
CTACTTCGTC GCGTCGTGCC GCGGCTGCGA GTGCTGCGGG AATGGGTACG AGAACTACTG CGCCAAGATG GTAACCACCT
GCAACGGCGT CGACCACGAC CACGGCGGCG GCGCGGCCAC CCAGGGCGGC TTCTCCGACG CCATCGTCGT CAACGAGCAC
TACGTGCTCC GCGTGCCGGC GGGGCTGCCG CTGGACAGCG CGGCGCCGCT GCTGTGCGCC GGCGTGACGG TGTACAGCCC
GATGGTGATC CACGGCCTGA ACGCGCCGGG GAAGCACGTC GGCGTCGTCG GCCTCGGCGG GCTCGGCCAC GTCGCCGTCA
AGTTCGCCAA GGCGTTCGGG ATGCGCGTCA CCGTCATCAG CACGTCGCCG GGGAAGCGGC AGGAGGCACT GGAGCACCTC
GGCGCCGACG AGTTCCTCGT CAGCCGCGAC GCGGGCCAGA TGGCGGCGGC GGCGGCCACC ATGGACGGGA TCCTCAACAC
GGTGTCGGCC TGGCACCCGA TCGCGCCGCT GTTCTCGCTG ATGAAGCCGA TGGCGCAGAT GGTGTTCGTC GGCGGGCCGA
CCAGGCCGCT GGAGCTGCCG GCGTACGCCA TCGTGCCCGG AGGGAAGGGC ATCACCGGCA ACTGCGTCGG CGGCATCAGG
GACTGCCAGG CCATGCTCGA CTTCGCCGGC GAGCACGGCA TCACTGCCGA GGTGGAGGTC ATCAAGATGG ACTACGTCAA
CACGGCGATG GAGCGGCTGG AGAAGAACGA TGTCCGCTAC CGCTTCGTCA TCGACGTTGC CGGCAGCAGC CTCGCCGGCT
CCGGCGACGC CAAGATATAA AGCTCGCCGG CTTGCTTGCT TGCTTGTGTC GACGGCGCCG GCGCCGCCTA GCTTGCTTGT
TGTGTGTCAG TGGCCTTGAA TGTTTGGTGA TGTGCAAACT ACTACGAAAT GGAGTAAGAA ATAAGTGGAG CATATGTCTC
CATCACTTGG TTATTAATTA GTCGAGCTAA TTAATTGTAC ATATTGAGAA ATGATGATAG GCCACATTGT TT

Locus: Os09g0400300

Loading...

Locus: Os09g0400300

Loading...