Os09t0401100-01

Locus

Os09g0401100

Description

Half-size ABC transporter, Mycorrhizal arbuscule formation

RAP-DB Gene Symbol Synonym(s)

ABCG21, OsABCG21, STR1

RAP-DB Gene Name Synonym(s)

ABC TRANSPORTER G FAMILY MEMBER 21, ABC transporter superfamily ABCG subgroup member 21, Medicago truncatula stunted arbuscule 1

CGSNL Gene Symbol

ABCG21

CGSNL Gene Name

ABC TRANSPORTER G FAMILY MEMBER 21

Oryzabase Gene Symbol Synonym(s)

OsABCG21, STR1

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 21, Medicago truncatula stunted arbuscule 1

Transcript Evidence

JN608807

Protein Evidence

G9I8W9

Literature

PMID: 22077667

Note

Manual Curation

March 17, 2015

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity (GO:0016887)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

ABC transporter-like (IPR003439)

AAA+ ATPase domain (IPR003593)

ABC-2 type transporter (IPR013525)

ABC transporter, conserved site (IPR017871)

Expression Databases

TENOR (Os09t0401100-00)

Others

Oryzabase (11998)

Transcript

2821 bp

>Os09t0401100-01 Half-size ABC transporter, Mycorrhizal arbuscule formation
AGGCTAGCTAGAAGGCTAACACAACAATGCAGCAGCAGCAGCGCAGCCGTGAGATGGCCA
GGGCCGGCGAGCCAGCCGCCGCCCACCGCCACCGCGCCGAGAGGGCCGCCGCCGGCGAGC
CGGCCACCCGAACTCACCGGACAGAGAGAGCCGGCGAGCCTGCcgcggccaccaccacca
ccaccacccgccggccgccgccgacgacgacggagaggaaggagagcctggagagcctcc
tggacgcgacggacgccgcccgtggcggccgtcgcggcggcggCGGCGTGAAGGCGGCGG
TGGCCAGCAGGCAAGGGCTGGAGTTCAAGAACCTGTCGTACAGCGTGGTGAAGAAGCAGA
AGAAGGAGGGGGTGAAGGTGAAGAAGGAGGTGTACCTGCTCAACGACATCTCCGGCGAGG
CCCCCCGCGGGCAGGTGACGGCGATCCTCGGCCCCAGCGGCGCCGGCAAGTCCACCTTCC
TCGACGCCCTCGCCGGCCGGATCGCCAAGGGCAGCCTCGAGGGCTCCGTCCGCATCGACG
GCCGAGCTGTCACGACGAGCTACATGAAGCAGATTTCATCCTACGTGATGCAAGATGATC
AGTTGTTCCCGATGCTGACGGTGCTGGAGACGCTCACTTTCGCAGCTGAAGTGAGGCTGC
CCCCATCACTCTCCAGAGCTGAGAAGCTCAAGCGAGTCTGGGAGCTCATCGATCAGCTTG
GTTTGCAGACAACGGCTCACACGTACATTGGGGATGAAGGGACCCGAGGAGTCTCCGGTG
GGGAACGCCGGAGGGTGTCGATCGGCATAGACATCATCCACAAACCTTCCCTCCTCTTCC
TCGACGAGCCGACCTCCGGTCTCGACTCCACCAGCGCGCACAGCGTGGTGGAGAAGGTGA
AGGACATCGCCAGAGGAGGGAGCATTGTGCTCATGACGATTCACCAGCCATCTTTCAGGA
TCCAGATGCTTCTTGACAGGCTTGTCATCCTCGCAAGGGGAAGGTTGATCTACCTAGGAA
GCCCAAGCACACTGCAAACACACCTGGCTGGATTTGGCAGGCCGGTGCCGGATGGTGAGA
ACAGCATTGAGTATCTCCTGGATGTCATCAAGGAGTACGATGAATCAACATCGGGGCTTG
AGCCTCTGGTTGCCTACCAGAGGGACGGCACGAAACCCGACGGCGCCGCGAAAACTCCGG
TGCCAAGAACACCGAGAACGCCGCACCAGAAGTCGGTGCAGTTCAGGCAGATCCAACTCA
AGAGCAACCAGTTCTCCCTCAACAGCGGCGCCGCCAATGGCAACACCTTCTCCAACTTCG
AGTCGTCGTACAATGTCGATGGCGGCGGCGATGACGACGATGAGGATTTTGATAATTCGC
TCGAGAGGAAGTTGCAGACGCCGATGCACGCCGGCGGTCCAGCTTCGGGGTACCAGCCGA
GGCTGGCGTCACAGTTCTACAAGGATTTCTCGGTCTGGGTCTACCATGGCGTCACCGGGA
GCACGCCGCACCGGCGGCCGACATGGACACCGGCGAGAACGCCGGTGTCGAGCTTCCAGC
GTGGCCGCGCCGTGACAATGACGCCAACGCCGCAGAACAACCCGCAGCGGCGGCCTCCTC
CGCCTCCGTCTCCACATGTGCCGGTGTTCAAGCCGGAGGAGCCGACGTACCACGAGTACG
AGCTTGACCTGGAGCCGCCGCTGGACGCGCCGGAAGAGGACTACAACGGCGGCCATCGTC
CCAAGTTCGCCAACCCGTGGCCGCGGGAGGTGGCGGTGCTGTCGTGGCGCACGGTGCTCA
ACGTGGTGCGCACGCCGGAGCTGTTCCTCTCTAGGGAGGTGGTGCTCGCGGCGATGGCGG
TCATCCTCTCCACCATGTTCCGCCGCCTCGGCGCCGGCGACGTCCCGACGGTGAACCGGC
TGCTCAACTTCTACATCTTCGCCGTCTGCCTCGTCTTCTTCTCCTCCAACGACGCCGTGC
CAACCTTCATCCAGGAGCGGTTCATCTTCATCCGGGAGCGGTCGCACAACGCCTACAGGG
CGTCGTCCTACGTCGTCGCCTCCCTCGTCGTCTACCTCCCCTTCTTCGCCGTGCAAGGGC
TCACCTTCGCCGTGATCACCAAGCTGATGCTCCGGATGGAGAGCAGCCTGCTCCACTTCT
GGGTCATCCTCTTCGCCTCCCTCATCACCACCAACGCCTACGTCATGCTCGTCTCGGCGC
TCGTCCCCAGCTACATCACCGGCTACGCCGTCGTCATCGCGACGACGGCGCTCTTCTTCC
TCACCTGCGGCTTCTTCCTCAAGCGGACGCTCATCCCGGTGGGGTGGAGGTGGCTGCACT
ACGCCTCCGCGATCAAGTACCCGTTCGAGGCGCTGCTGGTGAGCGAGTTCAAGGGGGGCC
GGTGCTACGCCGGCGACCGCGCCGACCTCTCGCCGGGGCCGCTCGGGGGGTTCAAGCCCA
GCAGCCTCCGGCGGGAGCTCAACGCCAGCGACGCGGCGTGCCCGTTGATGGGGCAGGACG
TGCTCTCCACACTGGACATCACCATTGACAGCATCTGGGTTGATGTTGCCATCCTGCTTG
CATGGGGTGTCCTCTATCGCCTCCTCTTCTATGTTGTCTTGAGGTTCTACTCCAAGAATG
AGAGGAAGTGAATTACTATTAGGATGCAGGAAATGTATTATATATATACGGCATATGTGG
AGTATATGTGTTTGGTGCATTTGTAATCTTTGTTTGCAAGAAGTCATAAGGTAAACCTAT
GTTCTTCAAAAGGATTTTTTTGGGGAGAGAAAATCAATAATAAATTTGTTTTAACTGATT
C

CDS

2625 bp

>Os09t0401100-01 Half-size ABC transporter, Mycorrhizal arbuscule formation
ATGCAGCAGCAGCAGCGCAGCCGTGAGATGGCCAGGGCCGGCGAGCCAGCCGCCGCCCAC
CGCCACCGCGCCGAGAGGGCCGCCGCCGGCGAGCCGGCCACCCGAACTCACCGGACAGAG
AGAGCCGGCGAGCCTGCcgcggccaccaccaccaccaccacccgccggccgccgccgacg
acgacggagaggaaggagagcctggagagcctcctggacgcgacggacgccgcccgtggc
ggccgtcgcggcggcggCGGCGTGAAGGCGGCGGTGGCCAGCAGGCAAGGGCTGGAGTTC
AAGAACCTGTCGTACAGCGTGGTGAAGAAGCAGAAGAAGGAGGGGGTGAAGGTGAAGAAG
GAGGTGTACCTGCTCAACGACATCTCCGGCGAGGCCCCCCGCGGGCAGGTGACGGCGATC
CTCGGCCCCAGCGGCGCCGGCAAGTCCACCTTCCTCGACGCCCTCGCCGGCCGGATCGCC
AAGGGCAGCCTCGAGGGCTCCGTCCGCATCGACGGCCGAGCTGTCACGACGAGCTACATG
AAGCAGATTTCATCCTACGTGATGCAAGATGATCAGTTGTTCCCGATGCTGACGGTGCTG
GAGACGCTCACTTTCGCAGCTGAAGTGAGGCTGCCCCCATCACTCTCCAGAGCTGAGAAG
CTCAAGCGAGTCTGGGAGCTCATCGATCAGCTTGGTTTGCAGACAACGGCTCACACGTAC
ATTGGGGATGAAGGGACCCGAGGAGTCTCCGGTGGGGAACGCCGGAGGGTGTCGATCGGC
ATAGACATCATCCACAAACCTTCCCTCCTCTTCCTCGACGAGCCGACCTCCGGTCTCGAC
TCCACCAGCGCGCACAGCGTGGTGGAGAAGGTGAAGGACATCGCCAGAGGAGGGAGCATT
GTGCTCATGACGATTCACCAGCCATCTTTCAGGATCCAGATGCTTCTTGACAGGCTTGTC
ATCCTCGCAAGGGGAAGGTTGATCTACCTAGGAAGCCCAAGCACACTGCAAACACACCTG
GCTGGATTTGGCAGGCCGGTGCCGGATGGTGAGAACAGCATTGAGTATCTCCTGGATGTC
ATCAAGGAGTACGATGAATCAACATCGGGGCTTGAGCCTCTGGTTGCCTACCAGAGGGAC
GGCACGAAACCCGACGGCGCCGCGAAAACTCCGGTGCCAAGAACACCGAGAACGCCGCAC
CAGAAGTCGGTGCAGTTCAGGCAGATCCAACTCAAGAGCAACCAGTTCTCCCTCAACAGC
GGCGCCGCCAATGGCAACACCTTCTCCAACTTCGAGTCGTCGTACAATGTCGATGGCGGC
GGCGATGACGACGATGAGGATTTTGATAATTCGCTCGAGAGGAAGTTGCAGACGCCGATG
CACGCCGGCGGTCCAGCTTCGGGGTACCAGCCGAGGCTGGCGTCACAGTTCTACAAGGAT
TTCTCGGTCTGGGTCTACCATGGCGTCACCGGGAGCACGCCGCACCGGCGGCCGACATGG
ACACCGGCGAGAACGCCGGTGTCGAGCTTCCAGCGTGGCCGCGCCGTGACAATGACGCCA
ACGCCGCAGAACAACCCGCAGCGGCGGCCTCCTCCGCCTCCGTCTCCACATGTGCCGGTG
TTCAAGCCGGAGGAGCCGACGTACCACGAGTACGAGCTTGACCTGGAGCCGCCGCTGGAC
GCGCCGGAAGAGGACTACAACGGCGGCCATCGTCCCAAGTTCGCCAACCCGTGGCCGCGG
GAGGTGGCGGTGCTGTCGTGGCGCACGGTGCTCAACGTGGTGCGCACGCCGGAGCTGTTC
CTCTCTAGGGAGGTGGTGCTCGCGGCGATGGCGGTCATCCTCTCCACCATGTTCCGCCGC
CTCGGCGCCGGCGACGTCCCGACGGTGAACCGGCTGCTCAACTTCTACATCTTCGCCGTC
TGCCTCGTCTTCTTCTCCTCCAACGACGCCGTGCCAACCTTCATCCAGGAGCGGTTCATC
TTCATCCGGGAGCGGTCGCACAACGCCTACAGGGCGTCGTCCTACGTCGTCGCCTCCCTC
GTCGTCTACCTCCCCTTCTTCGCCGTGCAAGGGCTCACCTTCGCCGTGATCACCAAGCTG
ATGCTCCGGATGGAGAGCAGCCTGCTCCACTTCTGGGTCATCCTCTTCGCCTCCCTCATC
ACCACCAACGCCTACGTCATGCTCGTCTCGGCGCTCGTCCCCAGCTACATCACCGGCTAC
GCCGTCGTCATCGCGACGACGGCGCTCTTCTTCCTCACCTGCGGCTTCTTCCTCAAGCGG
ACGCTCATCCCGGTGGGGTGGAGGTGGCTGCACTACGCCTCCGCGATCAAGTACCCGTTC
GAGGCGCTGCTGGTGAGCGAGTTCAAGGGGGGCCGGTGCTACGCCGGCGACCGCGCCGAC
CTCTCGCCGGGGCCGCTCGGGGGGTTCAAGCCCAGCAGCCTCCGGCGGGAGCTCAACGCC
AGCGACGCGGCGTGCCCGTTGATGGGGCAGGACGTGCTCTCCACACTGGACATCACCATT
GACAGCATCTGGGTTGATGTTGCCATCCTGCTTGCATGGGGTGTCCTCTATCGCCTCCTC
TTCTATGTTGTCTTGAGGTTCTACTCCAAGAATGAGAGGAAGTGA

Protein

875 aa

>Os09t0401100-01 Half-size ABC transporter, Mycorrhizal arbuscule formation
MQQQQRSREMARAGEPAAAHRHRAERAAAGEPATRTHRTERAGEPAAATTTTTTRRPPPT
TTERKESLESLLDATDAARGGRRGGGGVKAAVASRQGLEFKNLSYSVVKKQKKEGVKVKK
EVYLLNDISGEAPRGQVTAILGPSGAGKSTFLDALAGRIAKGSLEGSVRIDGRAVTTSYM
KQISSYVMQDDQLFPMLTVLETLTFAAEVRLPPSLSRAEKLKRVWELIDQLGLQTTAHTY
IGDEGTRGVSGGERRRVSIGIDIIHKPSLLFLDEPTSGLDSTSAHSVVEKVKDIARGGSI
VLMTIHQPSFRIQMLLDRLVILARGRLIYLGSPSTLQTHLAGFGRPVPDGENSIEYLLDV
IKEYDESTSGLEPLVAYQRDGTKPDGAAKTPVPRTPRTPHQKSVQFRQIQLKSNQFSLNS
GAANGNTFSNFESSYNVDGGGDDDDEDFDNSLERKLQTPMHAGGPASGYQPRLASQFYKD
FSVWVYHGVTGSTPHRRPTWTPARTPVSSFQRGRAVTMTPTPQNNPQRRPPPPPSPHVPV
FKPEEPTYHEYELDLEPPLDAPEEDYNGGHRPKFANPWPREVAVLSWRTVLNVVRTPELF
LSREVVLAAMAVILSTMFRRLGAGDVPTVNRLLNFYIFAVCLVFFSSNDAVPTFIQERFI
FIRERSHNAYRASSYVVASLVVYLPFFAVQGLTFAVITKLMLRMESSLLHFWVILFASLI
TTNAYVMLVSALVPSYITGYAVVIATTALFFLTCGFFLKRTLIPVGWRWLHYASAIKYPF
EALLVSEFKGGRCYAGDRADLSPGPLGGFKPSSLRRELNASDAACPLMGQDVLSTLDITI
DSIWVDVAILLAWGVLYRLLFYVVLRFYSKNERK*

5'UTR

chr09:14046728..14046753 (+ strand) : 26 bp

CDS

chr09:14046754..14047275 (+ strand) : 522 bp

chr09:14047652..14047831 (+ strand) : 180 bp

chr09:14048074..14048342 (+ strand) : 269 bp

chr09:14048771..14050424 (+ strand) : 1654 bp

3'UTR

chr09:14050425..14050594 (+ strand) : 170 bp

FASTA

>Os09t0401100-01 class=Sequence position=chr09:14046728..14050594 (+ strand)
AGGCTAGCTA GAAGGCTAAC ACAACAATGC AGCAGCAGCA GCGCAGCCGT GAGATGGCCA GGGCCGGCGA GCCAGCCGCC
GCCCACCGCC ACCGCGCCGA GAGGGCCGCC GCCGGCGAGC CGGCCACCCG AACTCACCGG ACAGAGAGAG CCGGCGAGCC
TGCcgcggcc accaccacca ccaccacccg ccggccgccg ccgacgacga cggagaggaa ggagagcctg gagagcctcc
tggacgcgac ggacgccgcc cgtggcggcc gtcgcggcgg cggCGGCGTG AAGGCGGCGG TGGCCAGCAG GCAAGGGCTG
GAGTTCAAGA ACCTGTCGTA CAGCGTGGTG AAGAAGCAGA AGAAGGAGGG GGTGAAGGTG AAGAAGGAGG TGTACCTGCT
CAACGACATC TCCGGCGAGG CCCCCCGCGG GCAGGTGACG GCGATCCTCG GCCCCAGCGG CGCCGGCAAG TCCACCTTCC
TCGACGCCCT CGCCGGCCGG ATCGCCAAGG GCAGCCTCGA GGGCTCCGTC CGCATCGACG GCCGAGCTGT AAGATGAATC
GATGATCATC AAACACCCAT AAAATTAACC TACTTCCTCT GTTtccgttt catgttacaa gatgttttaa ctttggttaa
aaccaaacta ctttaaattt aactaagttt aaagaaaaaa taataacatt ttcaacctta gacaaattta ttatgaaaat
atatttaatt attgatttaa tgaaactaat tcggtattat aaatattact atatttgttt ataaacttag ttaaaaatta
gtttaacttt gacctaagtc aaatcgtctt gtaacttgaa acgaagagag taTACAGTTC TCTCGTTCTT CTGCATAATC
AAGTACACAA TTAAGATGAT CTCTTGTTCT TGTTGTTAAT TTAGGTCACG ACGAGCTACA TGAAGCAGAT TTCATCCTAC
GTGATGCAAG ATGATCAGTT GTTCCCGATG CTGACGGTGC TGGAGACGCT CACTTTCGCA GCTGAAGTGA GGCTGCCCCC
ATCACTCTCC AGAGCTGAGA AGCTCAAGCG AGTCTGGGAG CTCATCGATC AGCTTGGTTT GCAGGTAAGT CAATCAAATT
AATCCGATAG AGCAGTTTTC CGATACTTGA GAATGTACCA GGTCCAATTT AATACCGAGA GATACCAAAT TTTACATTAA
AAAAATACGG TATCCTTAGA ACCGTAAAAA TCTCTCTAAT CTGACCATTA AACAAATAAT ATCGACAGAA TTGTAGCTGG
TTATACTCTA CAAGCTAGGT TAGCAGCTTG CTCATTTTTA CTGACAATCT GTGTGCCAAA TTGCAGACAA CGGCTCACAC
GTACATTGGG GATGAAGGGA CCCGAGGAGT CTCCGGTGGG GAACGCCGGA GGGTGTCGAT CGGCATAGAC ATCATCCACA
AACCTTCCCT CCTCTTCCTC GACGAGCCGA CCTCCGGTCT CGACTCCACC AGCGCGCACA GCGTGGTGGA GAAGGTGAAG
GACATCGCCA GAGGAGGGAG CATTGTGCTC ATGACGATTC ACCAGCCATC TTTCAGGATC CAGATGCTTC TTGACAGGCT
TGTCATCCTC GCAAGGTGAC AAAACTATTT CTCCCTCCGT TTCAGGTTAT AAGATGTTTT GACtttggtc aaagtcaaac
tgcttcaagt ttgattaagt ttatagaaaa aatagtaata ttttttactc atgataaatt tattattaaa atatatttaa
ttattaattt aataaaatta ttttggtaat ataaatatta ctatattcgt ctataaactt ggtcaaactt aaaacagttt
gactttcaCC AAAGTTAAAA CCTTATAGAC TGAAACGAAA CGAGTTATAG ATAGTATTCC AAATTGTTAG TGTCTAATTT
TAAAAGTTTG ACCAAATCTT GTCTGAATGA CCGGAGGAAG TATCTGCCTA GGTCTAGAAT TGTCTTTTGC TTCCAAAATT
CCTTTTTTGT TCAATTTAAA AATACTGTCA TTGATTCATC CAGGGGAAGG TTGATCTACC TAGGAAGCCC AAGCACACTG
CAAACACACC TGGCTGGATT TGGCAGGCCG GTGCCGGATG GTGAGAACAG CATTGAGTAT CTCCTGGATG TCATCAAGGA
GTACGATGAA TCAACATCGG GGCTTGAGCC TCTGGTTGCC TACCAGAGGG ACGGCACGAA ACCCGACGGC GCCGCGAAAA
CTCCGGTGCC AAGAACACCG AGAACGCCGC ACCAGAAGTC GGTGCAGTTC AGGCAGATCC AACTCAAGAG CAACCAGTTC
TCCCTCAACA GCGGCGCCGC CAATGGCAAC ACCTTCTCCA ACTTCGAGTC GTCGTACAAT GTCGATGGCG GCGGCGATGA
CGACGATGAG GATTTTGATA ATTCGCTCGA GAGGAAGTTG CAGACGCCGA TGCACGCCGG CGGTCCAGCT TCGGGGTACC
AGCCGAGGCT GGCGTCACAG TTCTACAAGG ATTTCTCGGT CTGGGTCTAC CATGGCGTCA CCGGGAGCAC GCCGCACCGG
CGGCCGACAT GGACACCGGC GAGAACGCCG GTGTCGAGCT TCCAGCGTGG CCGCGCCGTG ACAATGACGC CAACGCCGCA
GAACAACCCG CAGCGGCGGC CTCCTCCGCC TCCGTCTCCA CATGTGCCGG TGTTCAAGCC GGAGGAGCCG ACGTACCACG
AGTACGAGCT TGACCTGGAG CCGCCGCTGG ACGCGCCGGA AGAGGACTAC AACGGCGGCC ATCGTCCCAA GTTCGCCAAC
CCGTGGCCGC GGGAGGTGGC GGTGCTGTCG TGGCGCACGG TGCTCAACGT GGTGCGCACG CCGGAGCTGT TCCTCTCTAG
GGAGGTGGTG CTCGCGGCGA TGGCGGTCAT CCTCTCCACC ATGTTCCGCC GCCTCGGCGC CGGCGACGTC CCGACGGTGA
ACCGGCTGCT CAACTTCTAC ATCTTCGCCG TCTGCCTCGT CTTCTTCTCC TCCAACGACG CCGTGCCAAC CTTCATCCAG
GAGCGGTTCA TCTTCATCCG GGAGCGGTCG CACAACGCCT ACAGGGCGTC GTCCTACGTC GTCGCCTCCC TCGTCGTCTA
CCTCCCCTTC TTCGCCGTGC AAGGGCTCAC CTTCGCCGTG ATCACCAAGC TGATGCTCCG GATGGAGAGC AGCCTGCTCC
ACTTCTGGGT CATCCTCTTC GCCTCCCTCA TCACCACCAA CGCCTACGTC ATGCTCGTCT CGGCGCTCGT CCCCAGCTAC
ATCACCGGCT ACGCCGTCGT CATCGCGACG ACGGCGCTCT TCTTCCTCAC CTGCGGCTTC TTCCTCAAGC GGACGCTCAT
CCCGGTGGGG TGGAGGTGGC TGCACTACGC CTCCGCGATC AAGTACCCGT TCGAGGCGCT GCTGGTGAGC GAGTTCAAGG
GGGGCCGGTG CTACGCCGGC GACCGCGCCG ACCTCTCGCC GGGGCCGCTC GGGGGGTTCA AGCCCAGCAG CCTCCGGCGG
GAGCTCAACG CCAGCGACGC GGCGTGCCCG TTGATGGGGC AGGACGTGCT CTCCACACTG GACATCACCA TTGACAGCAT
CTGGGTTGAT GTTGCCATCC TGCTTGCATG GGGTGTCCTC TATCGCCTCC TCTTCTATGT TGTCTTGAGG TTCTACTCCA
AGAATGAGAG GAAGTGAATT ACTATTAGGA TGCAGGAAAT GTATTATATA TATACGGCAT ATGTGGAGTA TATGTGTTTG
GTGCATTTGT AATCTTTGTT TGCAAGAAGT CATAAGGTAA ACCTATGTTC TTCAAAAGGA TTTTTTTGGG GAGAGAAAAT
CAATAATAAA TTTGTTTTAA CTGATTC

Locus: Os09g0401100

Loading...

Locus: Os09g0401100

Loading...