Os09t0411650-01

Locus

Os09g0411650

Description

Similar to Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N- methyltransferase, chloroplast precursor (EC 2.1.1.127) ([Ribulose- bisphosphate carboxylase]-lysine N-methyltransferase) (RuBisCO methyltransferase) (RuBisco LSMT) (rbcMT).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET36

Oryzabase Gene Name Synonym(s)

SET protein 36

Transcript Evidence

AK243615 (DDBJ, Best hit)

Protein Evidence

XP_002311320.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: chloroplast (GO:0009507)

Molecular Function: protein binding (GO:0005515)

Molecular Function: [ribulose-bisphosphate carboxylase]-lysine N-methyltransferase activity (GO:0030785)

Functional domain (InterPro)

SET domain (IPR001214)

Rubisco methyltransferase (IPR011192)

Rubisco LS methyltransferase, substrate-binding domain (IPR015353)

Full-length cDNA

J100085N23 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0411650-01)

Others

Oryzabase (13399)

KEGG (Os09t0411650-01 (EC:2.1.1.127))

Transcript

1635 bp

>Os09t0411650-01 Similar to Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N- methyltransferase, chloroplast precursor (EC 2.1.1.127) ([Ribulose- bisphosphate carboxylase]-lysine N-methyltransferase) (RuBisCO methyltransferase) (RuBisco LSMT) (rbcMT).
CTCTAATCCGCAACCCCGCTCTCGTCCGCCTTCTGGCTGCGCGCCATGGCTGCTGCCATC
CACCACCACCACCTCCTCCCTCCTCGCCTCCTCTCCGTCCACCCGCAGCCTCCCCGCCTC
CGCCTCCGGCGCCCGCTCCCCCGCCGCGCGGCCGCGTCCGGCGCAGCGGCCGGGACGTCG
TCGTCGACCGCGGCCGCGCCGCCGCCCACGGACGCCGCGCTGCAGGAGTTCAGGCGCTGG
GTGTCGTCCCACGGCGCGGACGCGGGGGCCGGCGCGGCGGCGCCCGCCGCCGTCCCCGAG
GGTGGCCTCGGCCTCGTCGCGGCGCGGGACCTGCCCCGCGGGGAGGTGCTCGCCGAGGTG
CCCAAGAAGCTCTGGCTGGACGCCGACGCCGTCGCGGCCTCCGACCTCGGCGGCGCCGTC
GGCCGCGGGGGGCTCAGGCCCTGGGTCGCCGTCGCGCTGCTTCTCCTCCGCGAGGCCGCC
CGCGGCGCCGGCTCGCCGTGGGCGCCCTACCTCGCCATCCTCCCGCGCCAGACCGACTCC
ACCATCTTCTGGTCAGAAGAAGAGCTCTTGGAGATACAAGGAACACAGTTACTGAGCACA
ACAATGGGTGTGAAGGAGTATGTGCAGAGTGAATTTGAGAGTGTTGAAGCTGAGATCATA
AGCGAGAACAGGGAGCTCTTTCCTGGTACTGTAACATTCAATGATTTCCTATGGGCATTC
GGCATACTCAGATCACGGGTGTTTGCGGAGCTCCGTGGAGATAAGCTTGCTCTCATACCA
TTTGCTGATCTTGTAAATCACAGCGATGATATAACCTCAAAAGAGTCCAGTTGGGAGATC
AAAGGAAAGGGTCTTTTTGGTAGGGATGTTGTGTTTTCTTTGCGAACACCGGTGAATGTT
AAATCTGGAGAACAGATATATATTCAGTATGATTTGGACAAGAGCAACGCAGAATTAGCG
CTTGATTATGGTTTCACCGAATCAAATTCATCAAGGGATGCATATACTCTGACCTTGGAG
ATATCTGAATCTGATCCATTTTATGATGACAAGCTTGACATTGCAGAGCTAAATGGGATG
GGGGAGACTGCATACTTTGATATTGTCCTTGGTGAATCTCTTCCTCCTCAAATGCTACCT
TACCTGCGATTACTCTGCCTTGGGGGAACAGATGCATTTCTCTTGGAAGCACTCTTCAGA
AATGCTGTTTGGGGCCACCTTGAACTGCCAGTGAGTCAAGATAATGAAGAAGCGATATGT
CAGGTCATCCGAAATGCCTGCAAATCTGCCCTTGGTGCTTACCACACTACCATAGAAGAG
GACGAAGAACTGTTGGGAAGTGAAAATCTTCAGCCAAGGCTTCAAATTGCCGTTGAAGTC
AGGGCCGGTGAGAAGAAAGTGCTACAGCAGATTGATGACATTTTCAAGCAGAGGGAGGAG
GAACTGGATGGCCTAGAGTACTACCAAGAACGGAGACTCAAGGATATTGGTTTAGTTGGC
GACAATGGTGAAATTATCTTCTGGGAATCCTAGAGACTTTTTATTCATTTTCTGAGGGTA
GAGAAGGTTTTGTAAAATGCCACTGTGCAATAGCAAATTAATGAAAGAAAAAGAGAAAAA
AAATGATATTCTAGC

CDS

1488 bp

>Os09t0411650-01 Similar to Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N- methyltransferase, chloroplast precursor (EC 2.1.1.127) ([Ribulose- bisphosphate carboxylase]-lysine N-methyltransferase) (RuBisCO methyltransferase) (RuBisco LSMT) (rbcMT).
ATGGCTGCTGCCATCCACCACCACCACCTCCTCCCTCCTCGCCTCCTCTCCGTCCACCCG
CAGCCTCCCCGCCTCCGCCTCCGGCGCCCGCTCCCCCGCCGCGCGGCCGCGTCCGGCGCA
GCGGCCGGGACGTCGTCGTCGACCGCGGCCGCGCCGCCGCCCACGGACGCCGCGCTGCAG
GAGTTCAGGCGCTGGGTGTCGTCCCACGGCGCGGACGCGGGGGCCGGCGCGGCGGCGCCC
GCCGCCGTCCCCGAGGGTGGCCTCGGCCTCGTCGCGGCGCGGGACCTGCCCCGCGGGGAG
GTGCTCGCCGAGGTGCCCAAGAAGCTCTGGCTGGACGCCGACGCCGTCGCGGCCTCCGAC
CTCGGCGGCGCCGTCGGCCGCGGGGGGCTCAGGCCCTGGGTCGCCGTCGCGCTGCTTCTC
CTCCGCGAGGCCGCCCGCGGCGCCGGCTCGCCGTGGGCGCCCTACCTCGCCATCCTCCCG
CGCCAGACCGACTCCACCATCTTCTGGTCAGAAGAAGAGCTCTTGGAGATACAAGGAACA
CAGTTACTGAGCACAACAATGGGTGTGAAGGAGTATGTGCAGAGTGAATTTGAGAGTGTT
GAAGCTGAGATCATAAGCGAGAACAGGGAGCTCTTTCCTGGTACTGTAACATTCAATGAT
TTCCTATGGGCATTCGGCATACTCAGATCACGGGTGTTTGCGGAGCTCCGTGGAGATAAG
CTTGCTCTCATACCATTTGCTGATCTTGTAAATCACAGCGATGATATAACCTCAAAAGAG
TCCAGTTGGGAGATCAAAGGAAAGGGTCTTTTTGGTAGGGATGTTGTGTTTTCTTTGCGA
ACACCGGTGAATGTTAAATCTGGAGAACAGATATATATTCAGTATGATTTGGACAAGAGC
AACGCAGAATTAGCGCTTGATTATGGTTTCACCGAATCAAATTCATCAAGGGATGCATAT
ACTCTGACCTTGGAGATATCTGAATCTGATCCATTTTATGATGACAAGCTTGACATTGCA
GAGCTAAATGGGATGGGGGAGACTGCATACTTTGATATTGTCCTTGGTGAATCTCTTCCT
CCTCAAATGCTACCTTACCTGCGATTACTCTGCCTTGGGGGAACAGATGCATTTCTCTTG
GAAGCACTCTTCAGAAATGCTGTTTGGGGCCACCTTGAACTGCCAGTGAGTCAAGATAAT
GAAGAAGCGATATGTCAGGTCATCCGAAATGCCTGCAAATCTGCCCTTGGTGCTTACCAC
ACTACCATAGAAGAGGACGAAGAACTGTTGGGAAGTGAAAATCTTCAGCCAAGGCTTCAA
ATTGCCGTTGAAGTCAGGGCCGGTGAGAAGAAAGTGCTACAGCAGATTGATGACATTTTC
AAGCAGAGGGAGGAGGAACTGGATGGCCTAGAGTACTACCAAGAACGGAGACTCAAGGAT
ATTGGTTTAGTTGGCGACAATGGTGAAATTATCTTCTGGGAATCCTAG

Protein

496 aa

>Os09t0411650-01 Similar to Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N- methyltransferase, chloroplast precursor (EC 2.1.1.127) ([Ribulose- bisphosphate carboxylase]-lysine N-methyltransferase) (RuBisCO methyltransferase) (RuBisco LSMT) (rbcMT).
MAAAIHHHHLLPPRLLSVHPQPPRLRLRRPLPRRAAASGAAAGTSSSTAAAPPPTDAALQ
EFRRWVSSHGADAGAGAAAPAAVPEGGLGLVAARDLPRGEVLAEVPKKLWLDADAVAASD
LGGAVGRGGLRPWVAVALLLLREAARGAGSPWAPYLAILPRQTDSTIFWSEEELLEIQGT
QLLSTTMGVKEYVQSEFESVEAEIISENRELFPGTVTFNDFLWAFGILRSRVFAELRGDK
LALIPFADLVNHSDDITSKESSWEIKGKGLFGRDVVFSLRTPVNVKSGEQIYIQYDLDKS
NAELALDYGFTESNSSRDAYTLTLEISESDPFYDDKLDIAELNGMGETAYFDIVLGESLP
PQMLPYLRLLCLGGTDAFLLEALFRNAVWGHLELPVSQDNEEAICQVIRNACKSALGAYH
TTIEEDEELLGSENLQPRLQIAVEVRAGEKKVLQQIDDIFKQREEELDGLEYYQERRLKD
IGLVGDNGEIIFWES*

5'UTR

chr09:14609818..14609862 (- strand) : 45 bp

CDS

chr09:14609312..14609817 (- strand) : 506 bp

chr09:14609137..14609165 (- strand) : 29 bp

chr09:14608807..14609018 (- strand) : 212 bp

chr09:14608431..14608553 (- strand) : 123 bp

chr09:14607926..14608330 (- strand) : 405 bp

chr09:14607621..14607833 (- strand) : 213 bp

3'UTR

chr09:14607519..14607620 (- strand) : 102 bp

FASTA

>Os09t0411650-01 class=Sequence position=chr09:14607519..14609862 (- strand)
CTCTAATCCG CAACCCCGCT CTCGTCCGCC TTCTGGCTGC GCGCCATGGC TGCTGCCATC CACCACCACC ACCTCCTCCC
TCCTCGCCTC CTCTCCGTCC ACCCGCAGCC TCCCCGCCTC CGCCTCCGGC GCCCGCTCCC CCGCCGCGCG GCCGCGTCCG
GCGCAGCGGC CGGGACGTCG TCGTCGACCG CGGCCGCGCC GCCGCCCACG GACGCCGCGC TGCAGGAGTT CAGGCGCTGG
GTGTCGTCCC ACGGCGCGGA CGCGGGGGCC GGCGCGGCGG CGCCCGCCGC CGTCCCCGAG GGTGGCCTCG GCCTCGTCGC
GGCGCGGGAC CTGCCCCGCG GGGAGGTGCT CGCCGAGGTG CCCAAGAAGC TCTGGCTGGA CGCCGACGCC GTCGCGGCCT
CCGACCTCGG CGGCGCCGTC GGCCGCGGGG GGCTCAGGCC CTGGGTCGCC GTCGCGCTGC TTCTCCTCCG CGAGGCCGCC
CGCGGCGCCG GCTCGCCGTG GGCGCCCTAC CTCGCCATCC TCCCGCGCCA GACCGACTCC ACCATCTTCT GGTGAGTTGA
GGTGATGCTG ATCGCTCATC GCTCTTCATG TGTTCGACGA AATGCTCCTT TTTGTTTTGG GTGGTTCATC ACGATTAACC
TCACATTCCT CTCCGTGCTG ATGCTTTTGA GTGGTTTGCT TCGTGCCTCC AGTGCAGGTC AGAAGAAGAG CTCTTGGAGA
TACAAGGTGG GCGTCCATTG CAAAAAGTTC AAAATCCATG AATTTAAATT ACAAAGCGAG CTCGTTTTGT TCATACTGGT
TGCTAGTATC TTTGTTGAAA TCTGTATGCT TTTGTTCCTT GCAGGAACAC AGTTACTGAG CACAACAATG GGTGTGAAGG
AGTATGTGCA GAGTGAATTT GAGAGTGTTG AAGCTGAGAT CATAAGCGAG AACAGGGAGC TCTTTCCTGG TACTGTAACA
TTCAATGATT TCCTATGGGC ATTCGGCATA CTCAGATCAC GGGTGTTTGC GGAGCTCCGT GGAGATAAGC TTGCTCTCAT
ACCATTTGCT GATCTTGTAA GATCTTGAAA TGCAATCATG CCTGCATTTT CTATTTGCTT TTCCAACATG CTGTGAACCG
ACTTATCTTT GCAAAATAGA TACCACTGGA AACCATGCCT GTAATTTGTC ATGCCAAAAC GTTCAGAATA TTTTTATTAT
ACACTATAAT ATGCTCTTTC AATACTTTTC CCTCGATATA TAATACAAAT CCAACCAAAA TATTGGGAAA CCATTATGTT
CTAATCATTT TGGTGCTTTG CCAAACCAGG TAAATCACAG CGATGATATA ACCTCAAAAG AGTCCAGTTG GGAGATCAAA
GGAAAGGGTC TTTTTGGTAG GGATGTTGTG TTTTCTTTGC GAACACCGGT GAATGTTAAA TCTGGAGAAC AGGTACAAGT
TCCCATTTAT TCATTTTAAG GAAATCATAT AGTTGTGCAG CTGTGACTTT TGTTCACTGA CAACATTTAT ATACTAAATA
ATGTTTTGAC AGATATATAT TCAGTATGAT TTGGACAAGA GCAACGCAGA ATTAGCGCTT GATTATGGTT TCACCGAATC
AAATTCATCA AGGGATGCAT ATACTCTGAC CTTGGAGATA TCTGAATCTG ATCCATTTTA TGATGACAAG CTTGACATTG
CAGAGCTAAA TGGGATGGGG GAGACTGCAT ACTTTGATAT TGTCCTTGGT GAATCTCTTC CTCCTCAAAT GCTACCTTAC
CTGCGATTAC TCTGCCTTGG GGGAACAGAT GCATTTCTCT TGGAAGCACT CTTCAGAAAT GCTGTTTGGG GCCACCTTGA
ACTGCCAGTG AGTCAAGATA ATGAAGAAGC GATATGTCAG GTCATCCGAA ATGCCTGCAA ATCTGCCCTT GGTGCTTACC
ACACTACCAT AGAAGAGGTA TGTTTATAAC CCGAATAAGC ATTGTTCATT TTCTTTTTTA TGTTATTATC TCCAAATTAG
TATTACGAAA CATGTCAAAA TATATGTAGG ACGAAGAACT GTTGGGAAGT GAAAATCTTC AGCCAAGGCT TCAAATTGCC
GTTGAAGTCA GGGCCGGTGA GAAGAAAGTG CTACAGCAGA TTGATGACAT TTTCAAGCAG AGGGAGGAGG AACTGGATGG
CCTAGAGTAC TACCAAGAAC GGAGACTCAA GGATATTGGT TTAGTTGGCG ACAATGGTGA AATTATCTTC TGGGAATCCT
AGAGACTTTT TATTCATTTT CTGAGGGTAG AGAAGGTTTT GTAAAATGCC ACTGTGCAAT AGCAAATTAA TGAAAGAAAA
AGAGAAAAAA AATGATATTC TAGC

Locus: Os09g0411650

Loading...

Locus: Os09g0411650

Loading...