Os09t0414900-01

Locus

Os09g0414900

Description

Similar to GASA5-like protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK059073 (DDBJ, Best hit)

Protein Evidence

Q0VYL5 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Full-length cDNA

001-021-H09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0414900-01)

RiceXPro (AK059073)

Others

KEGG (Os09t0414900-01)

Transcript

696 bp

>Os09t0414900-01 Similar to GASA5-like protein (Fragment).
AAACTCGTCTTGGAACCCACTGCTTTGCCTATAAATATGTAGCTATAGCTTCTCTGCTTT
CCGTCGCTTAACACAGTTAACACCAACGCAGTGGTGCTCTCTCTTCAGTTAGTGGAGCTT
CAGAGAAATGGCTTTGGCTGGTAGGCTACTTGTCCTCTTCGCCATTGCTCTCCTTGCCAT
CTCCATAGCCGAGCACAAGGCGCTAGCCAAGGGATCAACCAGTGAGCATGATGATAACGT
TTACCAAGTAAGCAAGGGAGGACAGGGCAGCCTGAAGAGCTATCAGTGCTCGCCGCAGTG
CGCGTACCGGTGCAGCCAGACGCAGTACAAGAAGCCGTGCCTCTTCTTCTGCAACAAGTG
CTGCAACGCCTGCCTCTGCGTGCCGTCGGGCCTCTACGGCAACAAGGGCGAGTGCCCCTG
CTACAACAACTGGAAGACCAAGCGCGGCGGCCCCAAGTGCCCGTGAAAAAACCTTCAGTG
GACGCTCGAATTCTTTGGTCATTTCAGTACCCAAACTCTGCTCGCACGATGCCGATTGAT
TCTAGCATGGCCGTCGGGGCAGAGGCAGCTGTGGCTTCCTATACATTACATACACACGGT
TGTAAAAATGTACATCTGGGCTATCCATTGCTGTACGCCTGAACGGTTCCAGAGGGGTGA
TGCAAATCATGCAGATGCAGCTGTATCGCTACCACG

CDS

339 bp

>Os09t0414900-01 Similar to GASA5-like protein (Fragment).
ATGGCTTTGGCTGGTAGGCTACTTGTCCTCTTCGCCATTGCTCTCCTTGCCATCTCCATA
GCCGAGCACAAGGCGCTAGCCAAGGGATCAACCAGTGAGCATGATGATAACGTTTACCAA
GTAAGCAAGGGAGGACAGGGCAGCCTGAAGAGCTATCAGTGCTCGCCGCAGTGCGCGTAC
CGGTGCAGCCAGACGCAGTACAAGAAGCCGTGCCTCTTCTTCTGCAACAAGTGCTGCAAC
GCCTGCCTCTGCGTGCCGTCGGGCCTCTACGGCAACAAGGGCGAGTGCCCCTGCTACAAC
AACTGGAAGACCAAGCGCGGCGGCCCCAAGTGCCCGTGA

Protein

112 aa

>Os09t0414900-01 Similar to GASA5-like protein (Fragment).
MALAGRLLVLFAIALLAISIAEHKALAKGSTSEHDDNVYQVSKGGQGSLKSYQCSPQCAY
RCSQTQYKKPCLFFCNKCCNACLCVPSGLYGNKGECPCYNNWKTKRGGPKCP*

5'UTR

chr09:14828981..14829107 (+ strand) : 127 bp

CDS

chr09:14829108..14829179 (+ strand) : 72 bp

chr09:14829288..14829344 (+ strand) : 57 bp

chr09:14829454..14829481 (+ strand) : 28 bp

chr09:14830104..14830285 (+ strand) : 182 bp

3'UTR

chr09:14830286..14830515 (+ strand) : 230 bp

FASTA

>Os09t0414900-01 class=Sequence position=chr09:14828981..14830515 (+ strand)
AAACTCGTCT TGGAACCCAC TGCTTTGCCT ATAAATATGT AGCTATAGCT TCTCTGCTTT CCGTCGCTTA ACACAGTTAA
CACCAACGCA GTGGTGCTCT CTCTTCAGTT AGTGGAGCTT CAGAGAAATG GCTTTGGCTG GTAGGCTACT TGTCCTCTTC
GCCATTGCTC TCCTTGCCAT CTCCATAGCC GAGCACAAGG TGAGATCTAG TCTAGCTATA TATGTGTGCG TAGTTCATAA
GTTTCTCCAA GAAGCTTAAG CTTAATCATC TGCTAACTAG CTAGCTGTTC TTGCATTTTT CAATTAGGCG CTAGCCAAGG
GATCAACCAG TGAGCATGAT GATAACGTTT ACCAAGTAAG CAAGGTTAGT TTCCTCACAA CAGATGAATC GGTCCCTAGT
TCAGTTTCTG AGATCCAGCA GATTTAATCA TTTCACTCTA CTTACTTTCT TTGCGTAAAA ATCGTAATTG CAGGGAGGAC
AGGGCAGCCT GAAGAGCTAT CGTAAGTGAT AAATACTTCC TGTGATCCTG TCCATGCAAA CCTTTCTGTA GTTAGCTGCA
TTTTTTTCAC CCCTTCACCT TTCACCTGTC CTCTGTGGCA TGCATGCGTC GTGCATATGC ATATTAGTTC AGGCCGCATG
GTCTGATCTA ATAAAGAATC TGCTGCTGCT AAAATTTAAA TTTTAAAACT TAATTTTAAA ATAAATTTAG GGTATTTTTT
ATATTACATT GGTTTCTATA AGTAGCTATA TATATATATA TATATATTAT TTTTATTCGC TAATAAGCAG TAGTATACAC
TATGTTGCAT TGTTGTGGGT CAGCTAGGTG ACACTACAGC CTTACGTACA GGTAGTGTTT TGTCAAGTAC ATCTCCTATA
CAGAGCTAAA GTACAGTGGA CCAGTAGCAT TAATCCACTC ATTACTTCAT TAGTGATAAA ACAGTGACGA TCCAAAAATT
CAGATAACTT GAAACAAGCT AGATAGATCT GCACGCTGAA ATGCAGCAGC AGTAACCAGC CGCAAACGTT TGCATTGCAT
GGTTTGTCCA AGACACGGCT AAGCTGCAGC CAGATGCTAA TGAAAATGCT GTAACGTGTA AATTTGTTGG GTGGATGCTG
CAGAGTGCTC GCCGCAGTGC GCGTACCGGT GCAGCCAGAC GCAGTACAAG AAGCCGTGCC TCTTCTTCTG CAACAAGTGC
TGCAACGCCT GCCTCTGCGT GCCGTCGGGC CTCTACGGCA ACAAGGGCGA GTGCCCCTGC TACAACAACT GGAAGACCAA
GCGCGGCGGC CCCAAGTGCC CGTGAAAAAA CCTTCAGTGG ACGCTCGAAT TCTTTGGTCA TTTCAGTACC CAAACTCTGC
TCGCACGATG CCGATTGATT CTAGCATGGC CGTCGGGGCA GAGGCAGCTG TGGCTTCCTA TACATTACAT ACACACGGTT
GTAAAAATGT ACATCTGGGC TATCCATTGC TGTACGCCTG AACGGTTCCA GAGGGGTGAT GCAAATCATG CAGATGCAGC
TGTATCGCTA CCACG

Locus: Os09g0414900

Loading...

Locus: Os09g0414900

Loading...