Os09t0418500-00

Locus

Os09g0418500

Description

Similar to CBL-interacting protein kinase 14.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK27

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 27

Oryzabase Gene Symbol Synonym(s)

OsCIPK27, OsSnRK3.30, SnRK3.30

Oryzabase Gene Name Synonym(s)

Putative CBL-interacting protein kinase 27, Sucrose nonfermenting-1-related protein kinase 3.30

Transcript Evidence

EU970334 (DDBJ)

Protein Evidence

C4P7S4 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Domain of unknown function DUF390 (IPR007228)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Expression Databases

TENOR (Os09t0418500-00)

Others

Oryzabase (7415)

Transcript

2427 bp

>Os09t0418500-00 Similar to CBL-interacting protein kinase 14.
AGCAGATCGAGGGCGGCAAGGCAGGCAATGGAGGGGAAGGGGGTGCTGGAGGGGAGGTAC
GAGATGGGGCGGGTGCTGGGCCACGGCAACTTCGGTCGTGTGCACGCGGCGCGGGACGTG
CGCACGGGGCGCGCCGTGGCGATGAAGGTGGTGTCCAAGGACAAGGTGGAGCGCGCCGGG
ATGGCGGAGCAGATCAAGCGGGAGATCGCCGTGATGAAGATGGTGTCCCACCCGAGCGTC
GTGGAGCTCCACGAGGTGATGGCCACGCGCACCAAGGTGTACCTGGCGCTCGAGCTCGTC
CGGGGCGGCGAGCTGTTCGACCGGATCGCCCGCCACGGCCGCGTCGGGGAGGGCGTCGCG
CGGAGGTACTTCCGCCAGCTCGTCTCCGCCGTCGACTTCTGCCACGGCCGCGGGGTGTAC
caccgcgacctgaagcccgagaacctgctgctcgacgaggccgggaacctcaaggtcgcc
gacttcgggctcagcgcgctcgcctgccacgcgcgccccgacggcctcctccacaccgcc
tgcggcacgccggcgtacgtcgcccccgaggtgctcgccggcaacggctacgacggcgcc
aaggccgacctctggtcctgcggcgtcatcctctacgtgctgctcgccggcgcgctgccg
ttccaggacgacaacctcgtgtgcatgtaccgcaagatgcggcggggtgacttctgctgc
ccgccgtgggtgacgacggacgcccggaagctcatcaagtcgctgctcgaccccaacccg
gGCACCCGCATCACCGTCGCCGGCCTCCTCGAGACGCCGTGGTTCCGGAAGACGGCGCCC
GTCCCGCGCCCCATCATCGCCGACCCCGCGGCGGCGCCGGTGGACACGCGTGGCAATGCC
GGCGACGACAAGGACGAGCCGCCCGAGGTGCTGAACGCCTTCCACCTGATCTCCCTGTCC
GAGGGCTTCGACCTGTCGCCGCTGTTCGAGCACGACCCCGCCGCGTCGCCGGGGCGGGCC
ACGGCGCGCGCGGGCGGCACGCGGTTCGCGACGCGGGAGGCGGCGAGCGGCGTGGTCGCG
CGGCTGGAGGCGCTCGCGATGGGCGGCGCACGCgccctgcgcgcggaacgagcggagctc
gaggccgcatgggcacgcgttgaggaggggcggcgctcggtggacgccatggtggaggtg
ggccgtaaagctcaccgccgtcacgtctcggagcttgaagcccggaaggcggcgctgacg
gagatcgctcgtgaggtggaggaggagcgagcggccgccctcatcgctaccaccacgatg
attgaggcgcaagacgccctccgccttcaaaacgccagccgggaggcggagctgaaagaa
aagctcgacgccgcccagggagtccttgactccgccgctgcccgagagcggcgggtaaca
gagactgaggcggcgtcccggcggcgcgaggagtcccttgaggcccgtgctatggcgctg
gaagaacacgccggcgccgtggagaaaggcttgacggaccgcgaggccgccgctgctctc
cgggaggcgacgctggcggcgcacgaggccgcctgcgccgaggaggagtgcgcgctccgc
ctccgcgaggacacactcgctgagcgggagcgagctctcgaggaggctgaggccacgacc
aaacggctggcggacagcctgtccctccgcgaggcggcgcaggaggagcaggcgcgccgc
aatcttgaatgcgtccgcgccgagagagccgcactggagcagcgggctgctgacctcgag
gcgcgggaaaaggagctggacgcgagggcgcataccggtggggcggccgcgggcgaaagc
gacttagccgcccgcctcgcagctgccgaacacaccgtcgccgatatgcagcgagcgctg
gactcctccaccggggaggccgaggcccttcgcttggcgggcgagattgggcccggcatg
ctttgggatgcggtctcccgcctgaagcgcgccggtcggcaagcgggcctctggaaaggc
cagacgacggtgccccccaccaatctggaaggcctcgctccgcacctcaacaggatggcc
tgggttctcgaacaactccccgaggagcttgagaagaccatcaagtcatcctcgagggac
ctcgcgcggggagcggtcgaactcgtgctggcgagttaccaggcccgggaccccaacttc
tctccatggatggcgctggaggagttccctcccgggaccgaggacgacgcgcgcgcgcgg
gtcggggatgctgccgaccacatcgtcaacggcttcgagggctcggcccctcggctcgcg
ttcgcccccgactccgacgaggaggggaacgccagcagtgcaagcgacggtggcaacgag
gccggcgacctgggcgcgtcagaatga

CDS

2427 bp

>Os09t0418500-00 Similar to CBL-interacting protein kinase 14.
AGCAGATCGAGGGCGGCAAGGCAGGCAATGGAGGGGAAGGGGGTGCTGGAGGGGAGGTAC
GAGATGGGGCGGGTGCTGGGCCACGGCAACTTCGGTCGTGTGCACGCGGCGCGGGACGTG
CGCACGGGGCGCGCCGTGGCGATGAAGGTGGTGTCCAAGGACAAGGTGGAGCGCGCCGGG
ATGGCGGAGCAGATCAAGCGGGAGATCGCCGTGATGAAGATGGTGTCCCACCCGAGCGTC
GTGGAGCTCCACGAGGTGATGGCCACGCGCACCAAGGTGTACCTGGCGCTCGAGCTCGTC
CGGGGCGGCGAGCTGTTCGACCGGATCGCCCGCCACGGCCGCGTCGGGGAGGGCGTCGCG
CGGAGGTACTTCCGCCAGCTCGTCTCCGCCGTCGACTTCTGCCACGGCCGCGGGGTGTAC
caccgcgacctgaagcccgagaacctgctgctcgacgaggccgggaacctcaaggtcgcc
gacttcgggctcagcgcgctcgcctgccacgcgcgccccgacggcctcctccacaccgcc
tgcggcacgccggcgtacgtcgcccccgaggtgctcgccggcaacggctacgacggcgcc
aaggccgacctctggtcctgcggcgtcatcctctacgtgctgctcgccggcgcgctgccg
ttccaggacgacaacctcgtgtgcatgtaccgcaagatgcggcggggtgacttctgctgc
ccgccgtgggtgacgacggacgcccggaagctcatcaagtcgctgctcgaccccaacccg
gGCACCCGCATCACCGTCGCCGGCCTCCTCGAGACGCCGTGGTTCCGGAAGACGGCGCCC
GTCCCGCGCCCCATCATCGCCGACCCCGCGGCGGCGCCGGTGGACACGCGTGGCAATGCC
GGCGACGACAAGGACGAGCCGCCCGAGGTGCTGAACGCCTTCCACCTGATCTCCCTGTCC
GAGGGCTTCGACCTGTCGCCGCTGTTCGAGCACGACCCCGCCGCGTCGCCGGGGCGGGCC
ACGGCGCGCGCGGGCGGCACGCGGTTCGCGACGCGGGAGGCGGCGAGCGGCGTGGTCGCG
CGGCTGGAGGCGCTCGCGATGGGCGGCGCACGCgccctgcgcgcggaacgagcggagctc
gaggccgcatgggcacgcgttgaggaggggcggcgctcggtggacgccatggtggaggtg
ggccgtaaagctcaccgccgtcacgtctcggagcttgaagcccggaaggcggcgctgacg
gagatcgctcgtgaggtggaggaggagcgagcggccgccctcatcgctaccaccacgatg
attgaggcgcaagacgccctccgccttcaaaacgccagccgggaggcggagctgaaagaa
aagctcgacgccgcccagggagtccttgactccgccgctgcccgagagcggcgggtaaca
gagactgaggcggcgtcccggcggcgcgaggagtcccttgaggcccgtgctatggcgctg
gaagaacacgccggcgccgtggagaaaggcttgacggaccgcgaggccgccgctgctctc
cgggaggcgacgctggcggcgcacgaggccgcctgcgccgaggaggagtgcgcgctccgc
ctccgcgaggacacactcgctgagcgggagcgagctctcgaggaggctgaggccacgacc
aaacggctggcggacagcctgtccctccgcgaggcggcgcaggaggagcaggcgcgccgc
aatcttgaatgcgtccgcgccgagagagccgcactggagcagcgggctgctgacctcgag
gcgcgggaaaaggagctggacgcgagggcgcataccggtggggcggccgcgggcgaaagc
gacttagccgcccgcctcgcagctgccgaacacaccgtcgccgatatgcagcgagcgctg
gactcctccaccggggaggccgaggcccttcgcttggcgggcgagattgggcccggcatg
ctttgggatgcggtctcccgcctgaagcgcgccggtcggcaagcgggcctctggaaaggc
cagacgacggtgccccccaccaatctggaaggcctcgctccgcacctcaacaggatggcc
tgggttctcgaacaactccccgaggagcttgagaagaccatcaagtcatcctcgagggac
ctcgcgcggggagcggtcgaactcgtgctggcgagttaccaggcccgggaccccaacttc
tctccatggatggcgctggaggagttccctcccgggaccgaggacgacgcgcgcgcgcgg
gtcggggatgctgccgaccacatcgtcaacggcttcgagggctcggcccctcggctcgcg
ttcgcccccgactccgacgaggaggggaacgccagcagtgcaagcgacggtggcaacgag
gccggcgacctgggcgcgtcagaatga

Protein

808 aa

>Os09t0418500-00 Similar to CBL-interacting protein kinase 14.
SRSRAARQAMEGKGVLEGRYEMGRVLGHGNFGRVHAARDVRTGRAVAMKVVSKDKVERAG
MAEQIKREIAVMKMVSHPSVVELHEVMATRTKVYLALELVRGGELFDRIARHGRVGEGVA
RRYFRQLVSAVDFCHGRGVYHRDLKPENLLLDEAGNLKVADFGLSALACHARPDGLLHTA
CGTPAYVAPEVLAGNGYDGAKADLWSCGVILYVLLAGALPFQDDNLVCMYRKMRRGDFCC
PPWVTTDARKLIKSLLDPNPGTRITVAGLLETPWFRKTAPVPRPIIADPAAAPVDTRGNA
GDDKDEPPEVLNAFHLISLSEGFDLSPLFEHDPAASPGRATARAGGTRFATREAASGVVA
RLEALAMGGARALRAERAELEAAWARVEEGRRSVDAMVEVGRKAHRRHVSELEARKAALT
EIAREVEEERAAALIATTTMIEAQDALRLQNASREAELKEKLDAAQGVLDSAAARERRVT
ETEAASRRREESLEARAMALEEHAGAVEKGLTDREAAAALREATLAAHEAACAEEECALR
LREDTLAERERALEEAEATTKRLADSLSLREAAQEEQARRNLECVRAERAALEQRAADLE
AREKELDARAHTGGAAAGESDLAARLAAAEHTVADMQRALDSSTGEAEALRLAGEIGPGM
LWDAVSRLKRAGRQAGLWKGQTTVPPTNLEGLAPHLNRMAWVLEQLPEELEKTIKSSSRD
LARGAVELVLASYQARDPNFSPWMALEEFPPGTEDDARARVGDAADHIVNGFEGSAPRLA
FAPDSDEEGNASSASDGGNEAGDLGASE*

CDS

chr09:15027311..15028423 (+ strand) : 1113 bp

chr09:15032987..15034300 (+ strand) : 1314 bp

FASTA

>Os09t0418500-00 class=Sequence position=chr09:15027311..15034300 (+ strand)
AGCAGATCGA GGGCGGCAAG GCAGGCAATG GAGGGGAAGG GGGTGCTGGA GGGGAGGTAC GAGATGGGGC GGGTGCTGGG
CCACGGCAAC TTCGGTCGTG TGCACGCGGC GCGGGACGTG CGCACGGGGC GCGCCGTGGC GATGAAGGTG GTGTCCAAGG
ACAAGGTGGA GCGCGCCGGG ATGGCGGAGC AGATCAAGCG GGAGATCGCC GTGATGAAGA TGGTGTCCCA CCCGAGCGTC
GTGGAGCTCC ACGAGGTGAT GGCCACGCGC ACCAAGGTGT ACCTGGCGCT CGAGCTCGTC CGGGGCGGCG AGCTGTTCGA
CCGGATCGCC CGCCACGGCC GCGTCGGGGA GGGCGTCGCG CGGAGGTACT TCCGCCAGCT CGTCTCCGCC GTCGACTTCT
GCCACGGCCG CGGGGTGTAC caccgcgacc tgaagcccga gaacctgctg ctcgacgagg ccgggaacct caaggtcgcc
gacttcgggc tcagcgcgct cgcctgccac gcgcgccccg acggcctcct ccacaccgcc tgcggcacgc cggcgtacgt
cgcccccgag gtgctcgccg gcaacggcta cgacggcgcc aaggccgacc tctggtcctg cggcgtcatc ctctacgtgc
tgctcgccgg cgcgctgccg ttccaggacg acaacctcgt gtgcatgtac cgcaagatgc ggcggggtga cttctgctgc
ccgccgtggg tgacgacgga cgcccggaag ctcatcaagt cgctgctcga ccccaacccg gGCACCCGCA TCACCGTCGC
CGGCCTCCTC GAGACGCCGT GGTTCCGGAA GACGGCGCCC GTCCCGCGCC CCATCATCGC CGACCCCGCG GCGGCGCCGG
TGGACACGCG TGGCAATGCC GGCGACGACA AGGACGAGCC GCCCGAGGTG CTGAACGCCT TCCACCTGAT CTCCCTGTCC
GAGGGCTTCG ACCTGTCGCC GCTGTTCGAG CACGACCCCG CCGCGTCGCC GGGGCGGGCC ACGGCGCGCG CGGGCGGCAC
GCGGTTCGCG ACGCGGGAGG CGGCGAGCGG CGTGGTCGCG CGGCTGGAGG CGCTCGCGAT GGGCGGCGCA CGCGTGGCGC
CGTCGTTGCT CATGGTGGAC GTCAAGAAGG ATGGCGGCGA CGCCATGGAG TACCGGCCGT TCTTCAGCGA GGAGCTCCGG
CCGGCGCTCA AGGACATCGT CTGGTCGCCG GCGGCGACCT GACGACACGG CGGGACGTCG CTGCCGCCAT TATTGCGCGT
CGTCGAATCG TATCCGTTGC TAATCCATTG GGGTGCATTA TTGTTTGGTG CCGAGGTGAT GTCTGGCTCG CTCGTTTGTC
CGTAGCAACT CGAAGTCGAT GGCTGCTGCT GCCTGCCACT GCTGCTGCTA GTGTTGCTGG CTAGCTTGCT GCCTTTGGTG
TAGTAGTAGC CTAGTAGGTC GGTATCTGCG CGCGGGAAAG GCAGAGGAAT TTTGGCGCGA TTCTGCGTCG CGTTCTGCCC
ATGCCGATGT GACGGTTTAT GAATCAGTGT GCATATTTTT CTTCGTTTTT GTTTTTTACC CATGTTTTCG TTTTACAAAT
GCTGAGTCTT TTTACCTTAT GCAACCATGT CTCCTTGGTG TGTGTGAACG TTTCTCGGCG AATTGATGTT ATAATTAGCT
ATACCTTGTT AAGTAAAGGC AGAAAATATA TTCTATTATC TTAAAAAAAA AGTTTTCATC TTATAAATGC TAAGAGTCAG
TGTAGACTTG TTGTTAACCA TTATAACAAT GGTTTCTCTC CTTTTCATGA TTAGCAAATA TTCTATTATA AAAACTAAGT
GTCCCTAATA ACGACCATTG TACATTCTTA GATAGCTGGA AATCATGTTT GCAACTTTTA GAGATGCCTC TATTAATGAC
TACTCTACAT GAAAAATGAT TTAGATCGAG ATGAAGCGGG CTATCAAGCT CCATGGTTGT GGGGCTATAG TGGTTGACAG
GTGAGCTTGG GAGTCTCTGG CCTATGTCAT CTTTATTAAC ATCAGTGGCG GCCGTGGCGT CGTTGATCAC AATGAAGGtg
acggagctcg ttgcccctca ccgggagact gcgcaagccc ccctttgccg gttcgaccag gggcttaggg tgcaatccca
agctctctct ctctctctgt atgtggaaag atcacccgcc cgcaagacac acgagacacg gcgatgtata caggttcggg
ccgctgcgaa gcgtaatacc ctactcctgt gtttttgtgg atttgtgtat ggacaaatta caaaggatta acttcctttc
ccctcagcct tccaaaaagg aaaaagtcct cccctctaaa tgggcaaggt cctcctttta tatctcaagg ggataccaca
tgcacctttc tctctccaaa ctggactgtt ctttttctct ttaatgggcg gagatcggta cggtttccat ccgggagccc
ttctgatggg acagcccaca cctaccccca cctcccccga agacagagat gacgcgggac cgtggctgtc tgtcgatgac
gcgaccagtg ccagaccggt cattcttgtt caccacgcgt cagcttaaca acgtgcatgt ttgcccttct tcgtgtaaca
ccttgcctgt aatggttagg atgaagcctg gtataaatct gaccagggct atcgtgccat ctctaagaga taacacgcta
gctccggctt gagacgagtg cctagaggct ttcgtcttga cgggatgggg caaggcgtgc gtcagaccgc caatcgccac
ctaacccgtg atctgaccgg tctgtgactg gtcacagacc ggataaagga acgcgctgta cagcgttgca tgcagcgtga
cacgcttgac cagactgcaa taaatgctgt taggtgagca cagctgtgct cacttatccc atatatgtgg cgcagacttc
cttaaggggt cggggtgcct cggccctcgg ggccggggca agcgcagccc gacccccccc cccccctcgg gggaaatcag
gaggagggcg gacacctcac cctcgggccc gacgtccccg aaggtgccag gccacgtggg cgattgtgtc tgcctcaagc
ctctggtcat gatactcccg gttccatatc accgacagta gcccccggcg ttatgccaga gcaatttccc ttcccaaggg
aagcggtcag gtgtgacgcc acctctaaag cctggtgaca ggtgggaccg gtctccgtag ttgggcaaaa tacccaacgg
tctcaatcca tgcacattgg tattggtaac tttggttgtc cataatgggc ggtctattca agactgccac accacttgag
cagcgcgcga atctgggtga gcagatttgt ctcgcccgga gatacggtaa cgccgcttcg gtcggcgagc gtaattaacg
cgcgcacgat acaattcatt tcgattgcca caaccgcata tccacttcat gcgccgtaag cgggcgaatg ggattagtgg
aagcgtgggc acgggaaacg agggagcgag atagcgagat acgagggagc gaggtagtgg gcgcgagaaa cgaggagcca
gggccagcga tggcaagggt ataaaagcat cgagaaaagg atttgcttcc ttcctttcgc cattgttcct cttgccttcg
ccgcctgagc tctaactctt tctctgctac gccctacttt cgccacacgc gctcgttctc aatcatctct tcctccaccg
ccatggcacg gggctctgct ctgctcgacg gcagtgtact accgccttcc cgcatcgtga gcgagaggca cgccggacta
ccgcgccgct tcatgccgga gtccgccacc ggtcgggaga tagtgatgct gggcgagggg cgcccggcac cagactaccc
ggggcggtcc atcttcttcc tccccttcgc aatggctggg ctggtcccgc cattttcttc tttcttcatg gatgtcctgg
agttctacga tctccagatg gcgcacctca cccctaatgc ggtgatgaca ttggccatct tcgcgcacct gtgcgagatg
ttcattgggg tgcgcccctc tcttcagctg ttccggtggt tcttcaccgt gcagtcggtg tcaccgccgt cggtggttgg
cggctgctac ttccagccgc gggggccggt gttgaaccgc tacatcccct gcgtcctccg caagaagtgg gacgactaga
agagcgactg gttctacacc cccctcgcca atgaaacgcg cctccgactt ccaagccagc ccccggcgca ggtctccagc
tggcgggcgc cggtagatct gggggaggac tacgacgccg tcctcgatcg cctggcgggc ctgcgatccc aggggctcac
cggggccatg gtgtacggcg attacctccg tcgccggatt gcgccgctcc aacggcgcgc ccggagcgcc tgggagtaca
ctggacctga agactacatg cggacccacc agggagccag atgggattgg gctcccgagg acttcaagat cgtggtccaa
agggtgctga atcttagctc cgtggaggcg tctcgcattc ctcaggagat cctccccctc tgcagcgatc ccgaccgcgc
ctccattcta accattatga tgggggtcgg ggcctcagag gagagagccc ctaagggcca cgacggcgcg ggcgagcgcc
gccgggggga acaatctgcc ccaggagggg gtcgtgcttc tgggccccgc ttcgggggct cggggagcag ccgccctgcc
gacgcccagg ggaagaggaa gctgggagga acacctcccc catctcctcc ccgagggggc ggggcggcgc gtgccagcag
tcggcgcccg gagggagccg cgccgacgtc gcagcccgag ggagagcgca agaagaaacg gctccgcaag acgggggaga
cggaaccatg ccggggaaac ctgatttccc ctccaaggtg gtcattcaac cgaccccctc gcaggttcgt ctcactctca
ttgcaaccat ctttctccca aaaggaagtt ttttctttct cattttgttc gtcttctggt tttttcttct gcttcagcga
tgtcccgtcg cattcctccc gccaccccaa gtccggccag tccgaggccg aagatccagc ggccgcagag gagcggaggc
gagaatctga ccggcgtgaa gccgcagacc gccttcggga agctgaagag gccgcccggg aggccgcccg gattcgccaa
gcggaggaag ctgctcggga ggaggccgcc cgggctgagg aagccgctaa ggaggaggcc gcccgggctc gccaggctga
ggcaacagct gctgctggcg cgtcaactgg gcccactccc tcgggcaacc ctcaggcgac agcctccggg gaggctcgcg
acgaggccgc gggcacatcg cctgggccca cctccccggg cgacgcccag gatcaaacgg gtccggggga catccccgag
cccagcacgt cctccggggg gccgagccgc atcgccttct ctccaaggcg gctcttctcc tcatcttccg tcgccccgct
gagcgccgag cccattctgc aggccttggc cgccgcaaac accgcggtgc tagatgggtt cagcgcccaa gtggaggccc
tgcgcgcgga acgagcggag ctcgaggccg catgggcacg cgttgaggag gggcggcgct cggtggacgc catggtggag
gtgggccgta aagctcaccg ccgtcacgtc tcggagcttg aagcccggaa ggcggcgctg acggagatcg ctcgtgaggt
ggaggaggag cgagcggccg ccctcatcgc taccaccacg atgattgagg cgcaagacgc cctccgcctt caaaacgcca
gccgggaggc ggagctgaaa gaaaagctcg acgccgccca gggagtcctt gactccgccg ctgcccgaga gcggcgggta
acagagactg aggcggcgtc ccggcggcgc gaggagtccc ttgaggcccg tgctatggcg ctggaagaac acgccggcgc
cgtggagaaa ggcttgacgg accgcgaggc cgccgctgct ctccgggagg cgacgctggc ggcgcacgag gccgcctgcg
ccgaggagga gtgcgcgctc cgcctccgcg aggacacact cgctgagcgg gagcgagctc tcgaggaggc tgaggccacg
accaaacggc tggcggacag cctgtccctc cgcgaggcgg cgcaggagga gcaggcgcgc cgcaatcttg aatgcgtccg
cgccgagaga gccgcactgg agcagcgggc tgctgacctc gaggcgcggg aaaaggagct ggacgcgagg gcgcataccg
gtggggcggc cgcgggcgaa agcgacttag ccgcccgcct cgcagctgcc gaacacaccg tcgccgatat gcagcgagcg
ctggactcct ccaccgggga ggccgaggcc cttcgcttgg cgggcgagat tgggcccggc atgctttggg atgcggtctc
ccgcctgaag cgcgccggtc ggcaagcggg cctctggaaa ggccagacga cggtgccccc caccaatctg gaaggcctcg
ctccgcacct caacaggatg gcctgggttc tcgaacaact ccccgaggag cttgagaaga ccatcaagtc atcctcgagg
gacctcgcgc ggggagcggt cgaactcgtg ctggcgagtt accaggcccg ggaccccaac ttctctccat ggatggcgct
ggaggagttc cctcccggga ccgaggacga cgcgcgcgcg cgggtcgggg atgctgccga ccacatcgtc aacggcttcg
agggctcggc ccctcggctc gcgttcgccc ccgactccga cgaggagggg aacgccagca gtgcaagcga cggtggcaac
gaggccggcg acctgggcgc gtcagaatga 

Locus: Os09g0418500

Loading...

Locus: Os09g0418500

Loading...