Os09t0424300-01

Locus

Os09g0424300

Description

S-adenosylmethionine decarboxylase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SAMDC1, SAMDC, OsSAMDC4

Oryzabase Gene Name Synonym(s)

S-adenosylmethionine decarboxylase 1

Transcript Evidence

AK101535 (DDBJ, Best hit)

AK067682 (DDBJ, Best hit)

AK102445 (DDBJ, Best hit)

Protein Evidence

A2Z1D8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: spermine biosynthetic process (GO:0006597)

Biological Process: spermidine biosynthetic process (GO:0008295)

Molecular Function: adenosylmethionine decarboxylase activity (GO:0004014)

Functional domain (InterPro)

S-adenosylmethionine decarboxylase (IPR001985)

S-adenosylmethionine decarboxylase, core (IPR016067)

S-adenosylmethionine decarboxylase, conserved site (IPR018166)

S-adenosylmethionine decarboxylase subgroup (IPR018167)

Full-length cDNA

J033048C18 (Online Clone Ordering)

J013116D10 (Online Clone Ordering)

J033093N21 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0424300-01)

RiceXPro (AK101535)

Others

Oryzabase (14053)

KEGG (Os09t0424300-01 (EC:4.1.1.50))

Transcript

2001 bp

>Os09t0424300-01 S-adenosylmethionine decarboxylase.
CACGCCTCGGCAATCCAAAGCCCTCCTCGTCCTCGCAGAGCATCCATTGCCTCGATTTTC
TATTCCAAATTCCCCCACGCGAAGAACAGCCAGCGCCCTCCTCCTCCTCCTCCTTCGCCT
TCCTCCTGGTTTCTTGCCATCTTTCCAGGGAAGGAGGAACCGCGGCCCGGCCGCATTCTT
GGACAAGAATTGTTGGCATAAAGGAACATTTTGTTGATGTTCTAATGGAGTCAAAAGGTG
GCAAAAAGAAGTCTAGCAGTAGTAGTTCCATGTACGAAGCTCCCCTAGGCTACAAGATTG
AGGACGTTCGCCCAGCCGGAGGAATCAAGAAGTTCCAGTCTGCTGCTTACTCCAACTGCG
CTCGCAAGCCATCCTGATATTCCTTCACATGCCTTTCCCCGTAGAGTAGGAATTTCCTGC
AATTTTTCCTTTGTTTTGTTGCAATAAATCTCCCTTGGCTGGCTGCTTTCTCAATCTCTT
CCCTTGTCTTCTCCGATCTCTTCTTTCCTGTCTTGTCCACTGCTCCTTGCAACACTTGAT
CAAATGTCGATGTCCTTGGCTGATTCTTGGGGCTCTGCCCCTGCCTCGCCCATTGGGTTT
GAAGGCTATGAGAAGCGCCTTGAGATAACATTGTCTGATGCGCCCGTCTTTGTGGACCCC
TGTGGTCGCGGCCTTCGTGCCCTCTCACGTGAGCAGATCGACTCGTTCTTGGATCTTGCA
AAGTGTACCATTGTATCCCATCTTTCGAACAAGCACTTCGACTCATATGTGCTTTCAGAG
TCGAGCCTTTTTGTTTATCCCCACAAGGTTGTTCTGAAGACCTGTGGTACAACAAAGCTT
CTGCTCTCCATTCCTCGCATCCTTGAGCTTGCTGCAGAGTTGTCACTGCCTGTTCTATCA
GTGAAGTACTCTCGTGGGATGTTCATCTTCCCTGGAGCGCAGCCATCACCGCATCGCAGC
TTCTTGGAGGAGGTTTCTGTGCTCAACAGCTTCTTTGGTGGCCTCAAGTCAGGTGGCAAT
GCTTATGTCATTGGTGATGCATTCAAGCCCAAGAAGAAGTGGCATGTCTACTATGCCACA
GAAGAGCCTGAGCAGCCCATGGTTACACTCGAGATGTGCATGACTGGGCTGGATGCTAAG
AAAGCTGAGGTGTTCTTCAAGGATTCCACTGATGGCTCCTGCTCATCAGCTAAGGAGATG
ACTATGTTCTCTGGGATTTCTGAAATCATCCCTGAGATGGAGATTTGTGACTTTGAGTTT
GACCCGTGTGGGTACTCAATGAATGGCATTTATGGTCCCGCCGTCTCCACGATCCATGTC
ACTCCTGAGGAAGGTTTCAGCTATGCAAGCTATGAAGCAATGAACTTCAATCCTAGCTCC
TTGGTCTACGATGATTTGATCAAGAAGGTCCTGGCTTGTTTCTGCCCTTCAGACTTTTCG
GTCGCTGTTACCATCTTCGGTGGGCATGGTTTTGCCAAATCATGGGCAAAAGGTGCAGAG
GTTGATTCCTACATGTGCGATGATCTTGTTGAGCAAGAGCTTCCTGGTGGCGGTGTGCTG
ATGTATCAGAGTTTTACTGCTGTTACTCCTGGTGCTGTGTCACCGAGGTCGACCTTGGAT
GGCTGGAACAGCGATGGAGCAGAGATGGTTGCGAAGAGCAAAGAGATGAGTGTCTGCTGG
GAAGGAGAGAAGGCGGCGAAGAAGAAAGATGCAGATGCCTGAGAAATCGGCAGTTCTTCA
ACCTCAAGTTGCAAGTTTGATTCATCTGAAGTTTCTGAGACGCCTTATTTGGTTCTGCTC
TTGCAGTTTCGGTTAAGCAGCTGGCTGGGCTACCGGCAAAGCATATGTTACTTGTTCATT
GTTCTTTTATATCTGTCTGCCCAAATAAGTGCTCTAGATGGTTTGCTGCGTCTGCCATAG
TGAGCAATTCAGATTGTAGTAGAATTCTTATCTGTTGCCGATGCTCTTTAAGGGAGAATG
ATATGTAACTCGATTATTTTC

CDS

1179 bp

>Os09t0424300-01 S-adenosylmethionine decarboxylase.
ATGTCGATGTCCTTGGCTGATTCTTGGGGCTCTGCCCCTGCCTCGCCCATTGGGTTTGAA
GGCTATGAGAAGCGCCTTGAGATAACATTGTCTGATGCGCCCGTCTTTGTGGACCCCTGT
GGTCGCGGCCTTCGTGCCCTCTCACGTGAGCAGATCGACTCGTTCTTGGATCTTGCAAAG
TGTACCATTGTATCCCATCTTTCGAACAAGCACTTCGACTCATATGTGCTTTCAGAGTCG
AGCCTTTTTGTTTATCCCCACAAGGTTGTTCTGAAGACCTGTGGTACAACAAAGCTTCTG
CTCTCCATTCCTCGCATCCTTGAGCTTGCTGCAGAGTTGTCACTGCCTGTTCTATCAGTG
AAGTACTCTCGTGGGATGTTCATCTTCCCTGGAGCGCAGCCATCACCGCATCGCAGCTTC
TTGGAGGAGGTTTCTGTGCTCAACAGCTTCTTTGGTGGCCTCAAGTCAGGTGGCAATGCT
TATGTCATTGGTGATGCATTCAAGCCCAAGAAGAAGTGGCATGTCTACTATGCCACAGAA
GAGCCTGAGCAGCCCATGGTTACACTCGAGATGTGCATGACTGGGCTGGATGCTAAGAAA
GCTGAGGTGTTCTTCAAGGATTCCACTGATGGCTCCTGCTCATCAGCTAAGGAGATGACT
ATGTTCTCTGGGATTTCTGAAATCATCCCTGAGATGGAGATTTGTGACTTTGAGTTTGAC
CCGTGTGGGTACTCAATGAATGGCATTTATGGTCCCGCCGTCTCCACGATCCATGTCACT
CCTGAGGAAGGTTTCAGCTATGCAAGCTATGAAGCAATGAACTTCAATCCTAGCTCCTTG
GTCTACGATGATTTGATCAAGAAGGTCCTGGCTTGTTTCTGCCCTTCAGACTTTTCGGTC
GCTGTTACCATCTTCGGTGGGCATGGTTTTGCCAAATCATGGGCAAAAGGTGCAGAGGTT
GATTCCTACATGTGCGATGATCTTGTTGAGCAAGAGCTTCCTGGTGGCGGTGTGCTGATG
TATCAGAGTTTTACTGCTGTTACTCCTGGTGCTGTGTCACCGAGGTCGACCTTGGATGGC
TGGAACAGCGATGGAGCAGAGATGGTTGCGAAGAGCAAAGAGATGAGTGTCTGCTGGGAA
GGAGAGAAGGCGGCGAAGAAGAAAGATGCAGATGCCTGA

Protein

393 aa

>Os09t0424300-01 S-adenosylmethionine decarboxylase.
MSMSLADSWGSAPASPIGFEGYEKRLEITLSDAPVFVDPCGRGLRALSREQIDSFLDLAK
CTIVSHLSNKHFDSYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSV
KYSRGMFIFPGAQPSPHRSFLEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYATE
EPEQPMVTLEMCMTGLDAKKAEVFFKDSTDGSCSSAKEMTMFSGISEIIPEMEICDFEFD
PCGYSMNGIYGPAVSTIHVTPEEGFSYASYEAMNFNPSSLVYDDLIKKVLACFCPSDFSV
AVTIFGGHGFAKSWAKGAEVDSYMCDDLVEQELPGGGVLMYQSFTAVTPGAVSPRSTLDG
WNSDGAEMVAKSKEMSVCWEGEKAAKKKDADA*

5'UTR

chr09:15388901..15389096 (- strand) : 196 bp

chr09:15387490..15387649 (- strand) : 160 bp

chr09:15387200..15387386 (- strand) : 187 bp

CDS

chr09:15386021..15387199 (- strand) : 1179 bp

3'UTR

chr09:15385742..15386020 (- strand) : 279 bp

FASTA

>Os09t0424300-01 class=Sequence position=chr09:15385742..15389096 (- strand)
CACGCCTCGG CAATCCAAAG CCCTCCTCGT CCTCGCAGAG CATCCATTGC CTCGATTTTC TATTCCAAAT TCCCCCACGC
GAAGAACAGC CAGCGCCCTC CTCCTCCTCC TCCTTCGCCT TCCTCCTGGT TTCTTGCCAT CTTTCCAGGG AAGGAGGAAC
CGCGGCCCGG CCGCATTCTT GGACAAGAAT TGTTGGGTGA GTCTCGAGTC CCCCCCCCTC CTTACTTGTG GTTATGCTCA
TGTTGCTGTG CTATTCTGTA GAAGAAGATT GCATATTTGC ATGTACTATG CGCTTGGATT GTTTAGCGAG TCGCGGAGAT
GTTTCGTTTC GTAACGCGTT GGGGGTCTGG ATCCCGATTT AGCTTCTTGG GGATCGATTT GGGAGGGGAT TTAGGACCTG
TCTTCCCCTG TTCCTTTCTT GCATGCGTTG GGAATTTTGT TTGTTCTTTG TGGCGACCGG GCTGTTAGTT ATTAGAGAAC
GTATTGCGAG CTGTTCGGGT GCCTGGGCGA TTCTAGAAAG ATGTCTCTTT TGCTAATGGT TATTATTAGC TGAATCGCTG
ATATGGTGAA TCCAGGAAAG TTTCATGCTT TTTGTCCTAT GTCCTGTCTT TCTTTGTCAT ATTCGTACCT TTCCCAGTTT
GCGATGCCCA AGAAGCAACC TTTCTGTTGG AAACATCTAG TGCTCAATTC TTTATTTCAA ATTGTTGAAA TCTTCAAGGA
GCAGTTTATT GTGCGCCCTT GTTGATTGCT CTTGTTTCTG CCAGGTTTCC TTGTTAGGCT CTAGTTTTGC TCGTTGTTTA
CTGTAAATTC CCATGTATAT TAAGTTTGTG CAGTGCGCTG TCAGCTTGGC AAATGGGCTT TTCATTTCCT GATCGAAAAA
AAAAACAAAC CTGTGATTAA CAAGGGGAAA TTACCTTCAC TGTGCCTATT GGCATCATTC CAAGTTATTC ATGCTTTAGT
TCCTAGCCAT TAACTTAAGA TAGAAATAAG ATCCTGCCAG TTCACTAGTT TTCTTGTCAG TTTGATATAT ACTTTGATCT
TGTCTTTTCT GGTTGTTTTC CTTAATTTTG TCTGTGTTGT TCTAGTGCTT AATTAGTTGC CTCTCAGTTC TTCACATTCT
ATGTTTTTGA GTAAAACTCT GTCCATATGG CCGTTCTGTT ATGTATCTCA GCAATCTGCT TATATTTTTT TTTTTGCATC
CCCACACAAT TCTATTTGAC GTTGTAAAAA AGAAGAGAGA TAACTAGATA AGCGCAACTG ATGCTCTATA CTTAGTTTCA
CGGTTCTTGG TTTAATGCCT AAAAATTGTG CACTATCAGT ACTTCAATTA TGTTATCTAG TAGTGTTTTG TCTCCTCTGA
ATAATGCCTG CCATTCTTAT GCTGCTCTAC TGCTGAGAAA ACTACACTAT TTGAATTACT GATTGCTAAT TATGTTTCGA
TTAACAGCAT AAAGGAACAT TTTGTTGATG TTCTAATGGA GTCAAAAGGT GGCAAAAAGA AGTCTAGCAG TAGTAGTTCC
ATGTACGAAG CTCCCCTAGG CTACAAGATT GAGGACGTTC GCCCAGCCGG AGGAATCAAG AAGTTCCAGT CTGCTGCTTA
CTCCAACGTA AGCACCAAAA GATTTAAGCA GCATACTTTA AATAACAAAA ATATTTACAT TTATGAACTC TGGTTTCTAA
TGCTTATTTG GTTTATCTTT TCCTTTGCAG TGCGCTCGCA AGCCATCCTG ATATTCCTTC ACATGCCTTT CCCCGTAGAG
TAGGAATTTC CTGCAATTTT TCCTTTGTTT TGTTGCAATA AATCTCCCTT GGCTGGCTGC TTTCTCAATC TCTTCCCTTG
TCTTCTCCGA TCTCTTCTTT CCTGTCTTGT CCACTGCTCC TTGCAACACT TGATCAAATG TCGATGTCCT TGGCTGATTC
TTGGGGCTCT GCCCCTGCCT CGCCCATTGG GTTTGAAGGC TATGAGAAGC GCCTTGAGAT AACATTGTCT GATGCGCCCG
TCTTTGTGGA CCCCTGTGGT CGCGGCCTTC GTGCCCTCTC ACGTGAGCAG ATCGACTCGT TCTTGGATCT TGCAAAGTGT
ACCATTGTAT CCCATCTTTC GAACAAGCAC TTCGACTCAT ATGTGCTTTC AGAGTCGAGC CTTTTTGTTT ATCCCCACAA
GGTTGTTCTG AAGACCTGTG GTACAACAAA GCTTCTGCTC TCCATTCCTC GCATCCTTGA GCTTGCTGCA GAGTTGTCAC
TGCCTGTTCT ATCAGTGAAG TACTCTCGTG GGATGTTCAT CTTCCCTGGA GCGCAGCCAT CACCGCATCG CAGCTTCTTG
GAGGAGGTTT CTGTGCTCAA CAGCTTCTTT GGTGGCCTCA AGTCAGGTGG CAATGCTTAT GTCATTGGTG ATGCATTCAA
GCCCAAGAAG AAGTGGCATG TCTACTATGC CACAGAAGAG CCTGAGCAGC CCATGGTTAC ACTCGAGATG TGCATGACTG
GGCTGGATGC TAAGAAAGCT GAGGTGTTCT TCAAGGATTC CACTGATGGC TCCTGCTCAT CAGCTAAGGA GATGACTATG
TTCTCTGGGA TTTCTGAAAT CATCCCTGAG ATGGAGATTT GTGACTTTGA GTTTGACCCG TGTGGGTACT CAATGAATGG
CATTTATGGT CCCGCCGTCT CCACGATCCA TGTCACTCCT GAGGAAGGTT TCAGCTATGC AAGCTATGAA GCAATGAACT
TCAATCCTAG CTCCTTGGTC TACGATGATT TGATCAAGAA GGTCCTGGCT TGTTTCTGCC CTTCAGACTT TTCGGTCGCT
GTTACCATCT TCGGTGGGCA TGGTTTTGCC AAATCATGGG CAAAAGGTGC AGAGGTTGAT TCCTACATGT GCGATGATCT
TGTTGAGCAA GAGCTTCCTG GTGGCGGTGT GCTGATGTAT CAGAGTTTTA CTGCTGTTAC TCCTGGTGCT GTGTCACCGA
GGTCGACCTT GGATGGCTGG AACAGCGATG GAGCAGAGAT GGTTGCGAAG AGCAAAGAGA TGAGTGTCTG CTGGGAAGGA
GAGAAGGCGG CGAAGAAGAA AGATGCAGAT GCCTGAGAAA TCGGCAGTTC TTCAACCTCA AGTTGCAAGT TTGATTCATC
TGAAGTTTCT GAGACGCCTT ATTTGGTTCT GCTCTTGCAG TTTCGGTTAA GCAGCTGGCT GGGCTACCGG CAAAGCATAT
GTTACTTGTT CATTGTTCTT TTATATCTGT CTGCCCAAAT AAGTGCTCTA GATGGTTTGC TGCGTCTGCC ATAGTGAGCA
ATTCAGATTG TAGTAGAATT CTTATCTGTT GCCGATGCTC TTTAAGGGAG AATGATATGT AACTCGATTA TTTTC

Locus: Os09g0424300

Loading...

Locus: Os09g0424300

Loading...