Os09t0424300-03

Locus

Os09g0424300

Description

S-adenosylmethionine decarboxylase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

SAMDC1, SAMDC, OsSAMDC4

Oryzabase Gene Name Synonym(s)

S-adenosylmethionine decarboxylase 1

Transcript Evidence

AK100397 (DDBJ, Best hit)

Protein Evidence

Q6F4N6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: spermine biosynthetic process (GO:0006597)

Biological Process: spermidine biosynthetic process (GO:0008295)

Molecular Function: adenosylmethionine decarboxylase activity (GO:0004014)

Functional domain (InterPro)

S-adenosylmethionine decarboxylase (IPR001985)

S-adenosylmethionine decarboxylase, core (IPR016067)

S-adenosylmethionine decarboxylase, conserved site (IPR018166)

S-adenosylmethionine decarboxylase subgroup (IPR018167)

Full-length cDNA

J023086M03 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0424300-03)

RiceXPro (AK100397)

Others

Oryzabase (14053)

KEGG (Os09t0424300-03 (EC:4.1.1.50))

Transcript

2542 bp

>Os09t0424300-03 S-adenosylmethionine decarboxylase.
TGTGCGCCCTTGTTGATTGCTCTTGTTTCTGCCAGGTTTCCTTGTTAGGCTCTAGTTTTG
CTCGTTGTTTACTGTAAATTCCCATGTATATTAAGTTTGTGCAGTGCGCTGTCAGCTTGG
CAAATGGGCTTTTCATTTCCTGATCGAAAAAAAAAACAAACCTGTGATTAACAAGGGGAA
ATTACCTTCACTGTGCCTATTGGCATCATTCCAAGTTATTCATGCTTTAGTTCCTAGCCA
TTAACTTAAGATAGAAATAAGATCCTGCCAGTTCACTAGTTTTCTTGTCAGTTTGATATA
TACTTTGATCTTGTCTTTTCTGGTTGTTTTCCTTAATTTTGTCTGTGTTGTTCTAGTGCT
TAATTAGTTGCCTCTCAGTTCTTCACATTCTATGTTTTTGAGTAAAACTCTGTCCATATG
GCCGTTCTGTTATGTATCTCAGCAATCTGCTTATATTTTTTTTTTTGCATCCCCACACAA
TTCTATTTGACGTTGTAAAAAAGAAGAGAGATAACTAGATAAGCGCAACTGATGCTCTAT
ACTTAGTTTCACGGTTCTTGGTTTAATGCCTAAAAATTGTGCACTATCAGTACTTCAATT
ATGTTATCTAGTAGTGTTTTGTCTCCTCTGAATAATGCCTGCCATTCTTATGCTGCTCTA
CTGCTGAGAAAACTACACTATTTGAATTACTGATTGCTAATTATGTTTCGATTAACAGCA
TAAAGGAACATTTTGTTGATGTTCTAATGGAGTCAAAAGGTGGCAAAAAGAAGTCTAGCA
GTAGTAGTTCCATGTACGAAGCTCCCCTAGGCTACAAGATTGAGGACGTTCGCCCAGCCG
GAGGAATCAAGAAGTTCCAGTCTGCTGCTTACTCCAACTGCGCTCGCAAGCCATCCTGAT
ATTCCTTCACATGCCTTTCCCCGTAGAGTAGGAATTTCCTGCAATTTTTCCTTTGTTTTG
TTGCAATAAATCTCCCTTGGCTGGCTGCTTTCTCAATCTCTTCCCTTGTCTTCTCCGATC
TCTTCTTTCCTGTCTTGTCCACTGCTCCTTGCAACACTTGATCAAATGTCGATGTCCTTG
GCTGATTCTTGGGGCTCTGCCCCTGCCTCGCCCATTGGGTTTGAAGGCTATGAGAAGCGC
CTTGAGATAACATTGTCTGATGCGCCCGTCTTTGTGGACCCCTGTGGTCGCGGCCTTCGT
GCCCTCTCACGTGAGCAGATCGACTCGTTCTTGGATCTTGCAAAGTGTACCATTGTATCC
CATCTTTCGAACAAGCACTTCGACTCATATGTGCTTTCAGAGTCGAGCCTTTTTGTTTAT
CCCCACAAGGTTGTTCTGAAGACCTGTGGTACAACAAAGCTTCTGCTCTCCATTCCTCGC
ATCCTTGAGCTTGCTGCAGAGTTGTCACTGCCTGTTCTATCAGTGAAGTACTCTCGTGGG
ATGTTCATCTTCCCTGGAGCGCAGCCATCACCGCATCGCAGCTTCTTGGAGGAGGTTTCT
GTGCTCAACAGCTTCTTTGGTGGCCTCAAGTCAGGTGGCAATGCTTATGTCATTGGTGAT
GCATTCAAGCCCAAGAAGAAGTGGCATGTCTACTATGCCACAGAAGAGCCTGAGCAGCCC
ATGGTTACACTCGAGATGTGCATGACTGGGCTGGATGCTAAGAAAGCTGAGGTGTTCTTC
AAGGATTCCACTGATGGCTCCTGCTCATCAGCTAAGGAGATGACTATGTTCTCTGGGATT
TCTGAAATCATCCCTGAGATGGAGATTTGTGACTTTGAGTTTGACCCGTGTGGGTACTCA
ATGAATGGCATTTATGGTCCCGCCGTCTCCACGATCCATGTCACTCCTGAGGAAGGTTTC
AGCTATGCAAGCTATGAAGCAATGAACTTCAATCCTAGCTCCTTGGTCTACGATGATTTG
ATCAAGAAGGTCCTGGCTTGTTTCTGCCCTTCAGACTTTTCGGTCGCTGTTACCATCTTC
GGTGGGCATGGTTTTGCCAAATCATGGGCAAAAGGTGCAGAGGTTGATTCCTACATGTGC
GATGATCTTGTTGAGCAAGAGCTTCCTGGTGGCGGTGTGCTGATGTATCAGAGTTTTACT
GCTGTTACTCCTGGTGCTGTGTCACCGAGGTCGACCTTGGATGGCTGGAACAGCGATGGA
GCAGAGATGGTTGCGAAGAGCAAAGAGATGAGTGTCTGCTGGGAAGGAGAGAAGGCGGCG
AAGAAGAAAGATGCAGATGCCTGAGAAATCGGCAGTTCTTCAACCTCAAGTTGCAAGTTT
GATTCATCTGAAGTTTCTGAGACGCCTTATTTGGTTCTGCTCTTGCAGTTTCGGTTAAGC
AGCTGGCTGGGCTACCGGCAAAGCATATGTTACTTGTTCATTGTTCTTTTATATCTGTCT
GCCCAAATAAGTGCTCTAGATGGTTTGCTGCGTCTGCCATAGTGAGCAATTCAGATTGTA
GTAGAATTCTTATCTGTTGCCGATGCTCTTTAAGGGAGAATGATATGTAACTCGATTATT
TTCAATAACTATTGCAACTTCC

CDS

1179 bp

>Os09t0424300-03 S-adenosylmethionine decarboxylase.
ATGTCGATGTCCTTGGCTGATTCTTGGGGCTCTGCCCCTGCCTCGCCCATTGGGTTTGAA
GGCTATGAGAAGCGCCTTGAGATAACATTGTCTGATGCGCCCGTCTTTGTGGACCCCTGT
GGTCGCGGCCTTCGTGCCCTCTCACGTGAGCAGATCGACTCGTTCTTGGATCTTGCAAAG
TGTACCATTGTATCCCATCTTTCGAACAAGCACTTCGACTCATATGTGCTTTCAGAGTCG
AGCCTTTTTGTTTATCCCCACAAGGTTGTTCTGAAGACCTGTGGTACAACAAAGCTTCTG
CTCTCCATTCCTCGCATCCTTGAGCTTGCTGCAGAGTTGTCACTGCCTGTTCTATCAGTG
AAGTACTCTCGTGGGATGTTCATCTTCCCTGGAGCGCAGCCATCACCGCATCGCAGCTTC
TTGGAGGAGGTTTCTGTGCTCAACAGCTTCTTTGGTGGCCTCAAGTCAGGTGGCAATGCT
TATGTCATTGGTGATGCATTCAAGCCCAAGAAGAAGTGGCATGTCTACTATGCCACAGAA
GAGCCTGAGCAGCCCATGGTTACACTCGAGATGTGCATGACTGGGCTGGATGCTAAGAAA
GCTGAGGTGTTCTTCAAGGATTCCACTGATGGCTCCTGCTCATCAGCTAAGGAGATGACT
ATGTTCTCTGGGATTTCTGAAATCATCCCTGAGATGGAGATTTGTGACTTTGAGTTTGAC
CCGTGTGGGTACTCAATGAATGGCATTTATGGTCCCGCCGTCTCCACGATCCATGTCACT
CCTGAGGAAGGTTTCAGCTATGCAAGCTATGAAGCAATGAACTTCAATCCTAGCTCCTTG
GTCTACGATGATTTGATCAAGAAGGTCCTGGCTTGTTTCTGCCCTTCAGACTTTTCGGTC
GCTGTTACCATCTTCGGTGGGCATGGTTTTGCCAAATCATGGGCAAAAGGTGCAGAGGTT
GATTCCTACATGTGCGATGATCTTGTTGAGCAAGAGCTTCCTGGTGGCGGTGTGCTGATG
TATCAGAGTTTTACTGCTGTTACTCCTGGTGCTGTGTCACCGAGGTCGACCTTGGATGGC
TGGAACAGCGATGGAGCAGAGATGGTTGCGAAGAGCAAAGAGATGAGTGTCTGCTGGGAA
GGAGAGAAGGCGGCGAAGAAGAAAGATGCAGATGCCTGA

Protein

393 aa

>Os09t0424300-03 S-adenosylmethionine decarboxylase.
MSMSLADSWGSAPASPIGFEGYEKRLEITLSDAPVFVDPCGRGLRALSREQIDSFLDLAK
CTIVSHLSNKHFDSYVLSESSLFVYPHKVVLKTCGTTKLLLSIPRILELAAELSLPVLSV
KYSRGMFIFPGAQPSPHRSFLEEVSVLNSFFGGLKSGGNAYVIGDAFKPKKKWHVYYATE
EPEQPMVTLEMCMTGLDAKKAEVFFKDSTDGSCSSAKEMTMFSGISEIIPEMEICDFEFD
PCGYSMNGIYGPAVSTIHVTPEEGFSYASYEAMNFNPSSLVYDDLIKKVLACFCPSDFSV
AVTIFGGHGFAKSWAKGAEVDSYMCDDLVEQELPGGGVLMYQSFTAVTPGAVSPRSTLDG
WNSDGAEMVAKSKEMSVCWEGEKAAKKKDADA*

5'UTR

chr09:15387490..15388367 (- strand) : 878 bp

chr09:15387200..15387386 (- strand) : 187 bp

CDS

chr09:15386021..15387199 (- strand) : 1179 bp

3'UTR

chr09:15385723..15386020 (- strand) : 298 bp

FASTA

>Os09t0424300-03 class=Sequence position=chr09:15385723..15388367 (- strand)
TGTGCGCCCT TGTTGATTGC TCTTGTTTCT GCCAGGTTTC CTTGTTAGGC TCTAGTTTTG CTCGTTGTTT ACTGTAAATT
CCCATGTATA TTAAGTTTGT GCAGTGCGCT GTCAGCTTGG CAAATGGGCT TTTCATTTCC TGATCGAAAA AAAAAACAAA
CCTGTGATTA ACAAGGGGAA ATTACCTTCA CTGTGCCTAT TGGCATCATT CCAAGTTATT CATGCTTTAG TTCCTAGCCA
TTAACTTAAG ATAGAAATAA GATCCTGCCA GTTCACTAGT TTTCTTGTCA GTTTGATATA TACTTTGATC TTGTCTTTTC
TGGTTGTTTT CCTTAATTTT GTCTGTGTTG TTCTAGTGCT TAATTAGTTG CCTCTCAGTT CTTCACATTC TATGTTTTTG
AGTAAAACTC TGTCCATATG GCCGTTCTGT TATGTATCTC AGCAATCTGC TTATATTTTT TTTTTTGCAT CCCCACACAA
TTCTATTTGA CGTTGTAAAA AAGAAGAGAG ATAACTAGAT AAGCGCAACT GATGCTCTAT ACTTAGTTTC ACGGTTCTTG
GTTTAATGCC TAAAAATTGT GCACTATCAG TACTTCAATT ATGTTATCTA GTAGTGTTTT GTCTCCTCTG AATAATGCCT
GCCATTCTTA TGCTGCTCTA CTGCTGAGAA AACTACACTA TTTGAATTAC TGATTGCTAA TTATGTTTCG ATTAACAGCA
TAAAGGAACA TTTTGTTGAT GTTCTAATGG AGTCAAAAGG TGGCAAAAAG AAGTCTAGCA GTAGTAGTTC CATGTACGAA
GCTCCCCTAG GCTACAAGAT TGAGGACGTT CGCCCAGCCG GAGGAATCAA GAAGTTCCAG TCTGCTGCTT ACTCCAACGT
AAGCACCAAA AGATTTAAGC AGCATACTTT AAATAACAAA AATATTTACA TTTATGAACT CTGGTTTCTA ATGCTTATTT
GGTTTATCTT TTCCTTTGCA GTGCGCTCGC AAGCCATCCT GATATTCCTT CACATGCCTT TCCCCGTAGA GTAGGAATTT
CCTGCAATTT TTCCTTTGTT TTGTTGCAAT AAATCTCCCT TGGCTGGCTG CTTTCTCAAT CTCTTCCCTT GTCTTCTCCG
ATCTCTTCTT TCCTGTCTTG TCCACTGCTC CTTGCAACAC TTGATCAAAT GTCGATGTCC TTGGCTGATT CTTGGGGCTC
TGCCCCTGCC TCGCCCATTG GGTTTGAAGG CTATGAGAAG CGCCTTGAGA TAACATTGTC TGATGCGCCC GTCTTTGTGG
ACCCCTGTGG TCGCGGCCTT CGTGCCCTCT CACGTGAGCA GATCGACTCG TTCTTGGATC TTGCAAAGTG TACCATTGTA
TCCCATCTTT CGAACAAGCA CTTCGACTCA TATGTGCTTT CAGAGTCGAG CCTTTTTGTT TATCCCCACA AGGTTGTTCT
GAAGACCTGT GGTACAACAA AGCTTCTGCT CTCCATTCCT CGCATCCTTG AGCTTGCTGC AGAGTTGTCA CTGCCTGTTC
TATCAGTGAA GTACTCTCGT GGGATGTTCA TCTTCCCTGG AGCGCAGCCA TCACCGCATC GCAGCTTCTT GGAGGAGGTT
TCTGTGCTCA ACAGCTTCTT TGGTGGCCTC AAGTCAGGTG GCAATGCTTA TGTCATTGGT GATGCATTCA AGCCCAAGAA
GAAGTGGCAT GTCTACTATG CCACAGAAGA GCCTGAGCAG CCCATGGTTA CACTCGAGAT GTGCATGACT GGGCTGGATG
CTAAGAAAGC TGAGGTGTTC TTCAAGGATT CCACTGATGG CTCCTGCTCA TCAGCTAAGG AGATGACTAT GTTCTCTGGG
ATTTCTGAAA TCATCCCTGA GATGGAGATT TGTGACTTTG AGTTTGACCC GTGTGGGTAC TCAATGAATG GCATTTATGG
TCCCGCCGTC TCCACGATCC ATGTCACTCC TGAGGAAGGT TTCAGCTATG CAAGCTATGA AGCAATGAAC TTCAATCCTA
GCTCCTTGGT CTACGATGAT TTGATCAAGA AGGTCCTGGC TTGTTTCTGC CCTTCAGACT TTTCGGTCGC TGTTACCATC
TTCGGTGGGC ATGGTTTTGC CAAATCATGG GCAAAAGGTG CAGAGGTTGA TTCCTACATG TGCGATGATC TTGTTGAGCA
AGAGCTTCCT GGTGGCGGTG TGCTGATGTA TCAGAGTTTT ACTGCTGTTA CTCCTGGTGC TGTGTCACCG AGGTCGACCT
TGGATGGCTG GAACAGCGAT GGAGCAGAGA TGGTTGCGAA GAGCAAAGAG ATGAGTGTCT GCTGGGAAGG AGAGAAGGCG
GCGAAGAAGA AAGATGCAGA TGCCTGAGAA ATCGGCAGTT CTTCAACCTC AAGTTGCAAG TTTGATTCAT CTGAAGTTTC
TGAGACGCCT TATTTGGTTC TGCTCTTGCA GTTTCGGTTA AGCAGCTGGC TGGGCTACCG GCAAAGCATA TGTTACTTGT
TCATTGTTCT TTTATATCTG TCTGCCCAAA TAAGTGCTCT AGATGGTTTG CTGCGTCTGC CATAGTGAGC AATTCAGATT
GTAGTAGAAT TCTTATCTGT TGCCGATGCT CTTTAAGGGA GAATGATATG TAACTCGATT ATTTTCAATA ACTATTGCAA
CTTCC

Locus: Os09g0424300

Loading...

Locus: Os09g0424300

Loading...