Os09t0428000-00

Locus

Os09g0428000

Description

Glycosyl transferase, family 2 domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLC2

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE C2

Oryzabase Gene Symbol Synonym(s)

OsCslC2, OsCSLC2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AF435650 (DDBJ, Best hit)

Protein Evidence

NP_194887.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Glycosyl transferase, family 2 (IPR001173)

Expression Databases

TENOR (Os09t0428000-00)

RiceXPro (AF435650)

Others

Oryzabase (13889)

KEGG (Os09t0428000-00)

Transcript

1840 bp

>Os09t0428000-00 Glycosyl transferase, family 2 domain containing protein.
gaagatcaagccgaggattgaaggggacccgttcagggaaggatcagggtatcagcaccc
catggtgctcgtccagattcctatgtgcaatgaaaaggaggtctatgagcagtcgatttc
ggcggcttgccagctagattggcccagggagaagtttctgattcaggtgctcgacgattc
cagcgacgagagcattcagctgctgatcaaggcagaagtttccaagtggagccatcaggg
tgtgaacattgtgtatcggcatcgggtgctgaggaccggttataaagctgggaacctcaa
gtctgcaatgagctgtgactatgtcaaagattatgaatttgtcgccattttcgacgcgga
cttccagccaacaccagattttctcaagaaaacgataccacattttgaggggaatcctga
gcttggattggttcaagcacgatggagctttgtgaacaaggatgagaacctcttgacccg
tcttcagaatatcaacctgtgcttccactttgaagtagagcaacaggtcaatggagtctt
cttgaacttctttggtttcaatggaactgctggagtttggaggatccaagctctagaaga
atccgggggttggcttgagaggacgacggtggaggatatggatattgctgttcgagcaca
cctgaatggatggaaatttatcttcctcaatgatgtaaaggtcctgtgtgaactcccaga
atcctatgaagcatataggaaacagcaacaccggtggcattctggtccaatgcacctttt
ccggctgtgccttccggacatacttactgccaagatctcatcatggaagaaggcgaactt
aatactattattctttcttttgaggaaattgattcttccgttctattcattcacattgtt
ttgtgtcattcttccgctgaccatgtttgttcctgaggctgagctgcctgtttgggtcat
ctgttatgtgccagtttgcatgtccttcctgaacattctgccatcaccaagatcatttcc
tttcattgtgccatacctccttttcgagaacaccatgtcagtgacaaaattcaacgcaat
ggtgtctggactgtttaaacttggaagctcctacgaatggattgtcacaaagaagtctgg
tcgatcatcagaatcagatctttcaacagcagcggagagggatacaaaggatcttaccct
tcctcggctgcagaagcaaatatctgaaagtgaattgattgagctcaaaatgcagaaaga
acgccaagaaaaggcgccgcttggtgcaaaaaaggctaacaaagtctacaagaaggagct
tgctctctctcttctcctcctcaccgccgcaactcggagcctcttgtctgctcaaggaat
tcacttctatttccttctctttcagggggtatcattcctttttgttggcctcgatctaat
tggagaacagatagactgatCACTCTCAGGCTTTTGTCAAAACATAGAAAGCATGCCTCT
CTTCGTACACACACTGGTAATCAAGTTCTGAGAGTTCCAAACATGCCATGGAATTTTACT
TCATTTTGGACAAGTTACTTGTCCGTACAGATATGCAAAGGAGAATTTGTTCTGCAATCC
AGATTCAGGGCACAAAACCGGAGTGATCCAACAGGAATAAGCTGAAAGAGTAGATAGAAT
TCGTTCATTTGTACCCAGTCCATATAGAGTTCCAGCAATGTTCTTTGGATCCAAAAAATA
CTGAGATGTGTGCTGTTCATTTGTAAATCGTTAATACACAATTTGTTCTGATAAAATTAT
CAATTTGTATATATTCCTACTTTAGATAATGAAAATGTTT

CDS

1458 bp

>Os09t0428000-00 Glycosyl transferase, family 2 domain containing protein.
aagatcaagccgaggattgaaggggacccgttcagggaaggatcagggtatcagcacccc
atggtgctcgtccagattcctatgtgcaatgaaaaggaggtctatgagcagtcgatttcg
gcggcttgccagctagattggcccagggagaagtttctgattcaggtgctcgacgattcc
agcgacgagagcattcagctgctgatcaaggcagaagtttccaagtggagccatcagggt
gtgaacattgtgtatcggcatcgggtgctgaggaccggttataaagctgggaacctcaag
tctgcaatgagctgtgactatgtcaaagattatgaatttgtcgccattttcgacgcggac
ttccagccaacaccagattttctcaagaaaacgataccacattttgaggggaatcctgag
cttggattggttcaagcacgatggagctttgtgaacaaggatgagaacctcttgacccgt
cttcagaatatcaacctgtgcttccactttgaagtagagcaacaggtcaatggagtcttc
ttgaacttctttggtttcaatggaactgctggagtttggaggatccaagctctagaagaa
tccgggggttggcttgagaggacgacggtggaggatatggatattgctgttcgagcacac
ctgaatggatggaaatttatcttcctcaatgatgtaaaggtcctgtgtgaactcccagaa
tcctatgaagcatataggaaacagcaacaccggtggcattctggtccaatgcaccttttc
cggctgtgccttccggacatacttactgccaagatctcatcatggaagaaggcgaactta
atactattattctttcttttgaggaaattgattcttccgttctattcattcacattgttt
tgtgtcattcttccgctgaccatgtttgttcctgaggctgagctgcctgtttgggtcatc
tgttatgtgccagtttgcatgtccttcctgaacattctgccatcaccaagatcatttcct
ttcattgtgccatacctccttttcgagaacaccatgtcagtgacaaaattcaacgcaatg
gtgtctggactgtttaaacttggaagctcctacgaatggattgtcacaaagaagtctggt
cgatcatcagaatcagatctttcaacagcagcggagagggatacaaaggatcttaccctt
cctcggctgcagaagcaaatatctgaaagtgaattgattgagctcaaaatgcagaaagaa
cgccaagaaaaggcgccgcttggtgcaaaaaaggctaacaaagtctacaagaaggagctt
gctctctctcttctcctcctcaccgccgcaactcggagcctcttgtctgctcaaggaatt
cacttctatttccttctctttcagggggtatcattcctttttgttggcctcgatctaatt
ggagaacagatagactga

Protein

486 aa

>Os09t0428000-00 Glycosyl transferase, family 2 domain containing protein.
KIKPRIEGDPFREGSGYQHPMVLVQIPMCNEKEVYEQSISAACQLDWPREKFLIQVLDDS
SDESIQLLIKAEVSKWSHQGVNIVYRHRVLRTGYKAGNLKSAMSCDYVKDYEFVAIFDAD
FQPTPDFLKKTIPHFEGNPELGLVQARWSFVNKDENLLTRLQNINLCFHFEVEQQVNGVF
LNFFGFNGTAGVWRIQALEESGGWLERTTVEDMDIAVRAHLNGWKFIFLNDVKVLCELPE
SYEAYRKQQHRWHSGPMHLFRLCLPDILTAKISSWKKANLILLFFLLRKLILPFYSFTLF
CVILPLTMFVPEAELPVWVICYVPVCMSFLNILPSPRSFPFIVPYLLFENTMSVTKFNAM
VSGLFKLGSSYEWIVTKKSGRSSESDLSTAAERDTKDLTLPRLQKQISESELIELKMQKE
RQEKAPLGAKKANKVYKKELALSLLLLTAATRSLLSAQGIHFYFLLFQGVSFLFVGLDLI
GEQID*

5'UTR

chr09:15548565..15548565 (- strand) : 1 bp

CDS

chr09:15548466..15548564 (- strand) : 99 bp

chr09:15548063..15548371 (- strand) : 309 bp

chr09:15547693..15547983 (- strand) : 291 bp

chr09:15547484..15547597 (- strand) : 114 bp

chr09:15546753..15547397 (- strand) : 645 bp

3'UTR

chr09:15546372..15546752 (- strand) : 381 bp

FASTA

>Os09t0428000-00 class=Sequence position=chr09:15546372..15548565 (- strand)
gaagatcaag ccgaggattg aaggggaccc gttcagggaa ggatcagggt atcagcaccc catggtgctc gtccagattc
ctatgtgcaa tgaaaaggag gtaTAATTTA GCTGAATTCT CATCGGAATT TTGTATACTC TGTAGTTTTG TAGTGTGTTA
TGTTCATTCA TTGTGTGTGC TTACTATGAG Acaggtctat gagcagtcga tttcggcggc ttgccagcta gattggccca
gggagaagtt tctgattcag gtgctcgacg attccagcga cgagagcatt cagctgctga tcaaggcaga agtttccaag
tggagccatc agggtgtgaa cattgtgtat cggcatcggg tgctgaggac cggttataaa gctgggaacc tcaagtctgc
aatgagctgt gactatgtca aagattatga atttgtcgcc attttcgacg cggacttcca gccaacacca gattttctca
agaaaacgat accacatttt gaggtaacat attcctggag atactgcagt cttgataccg aacaccaatt cgatgctaag
tcaccgttgc aaattcacgc aggggaatcc tgagcttgga ttggttcaag cacgatggag ctttgtgaac aaggatgaga
acctcttgac ccgtcttcag aatatcaacc tgtgcttcca ctttgaagta gagcaacagg tcaatggagt cttcttgaac
ttctttggtt tcaatggaac tgctggagtt tggaggatcc aagctctaga agaatccggg ggttggcttg agaggacgac
ggtggaggat atggatattg ctgttcgagc acacctgaat ggatggaaat ttatcttcct caatgatgta aaggtacatt
atgtgtttgt gttagctgct gcattttgga ctaagggtca atctcatata tacacagaac ttgattttta cttggtacta
tcaatcaggt cctgtgtgaa ctcccagaat cctatgaagc atataggaaa cagcaacacc ggtggcattc tggtccaatg
caccttttcc ggctgtgcct tccggacata cttactgcca aggtaTGCAA TTCCATTAGC TAGAATCTTA TACATGTGCC
GGTAATTAAA GTTCTTTTTT GATAAATAct gctaatgttt caccacagat ctcatcatgg aagaaggcga acttaatact
attattcttt cttttgagga aattgattct tccgttctat tcattcacat tgttttgtgt cattcttccg ctgaccatgt
ttgttcctga ggctgagctg cctgtttggg tcatctgtta tgtgccagtt tgcatgtcct tcctgaacat tctgccatca
ccaagatcat ttcctttcat tgtgccatac ctccttttcg agaacaccat gtcagtgaca aaattcaacg caatggtgtc
tggactgttt aaacttggaa gctcctacga atggattgtc acaaagaagt ctggtcgatc atcagaatca gatctttcaa
cagcagcgga gagggataca aaggatctta cccttcctcg gctgcagaag caaatatctg aaagtgaatt gattgagctc
aaaatgcaga aagaacgcca agaaaaggcg ccgcttggtg caaaaaaggc taacaaagtc tacaagaagg agcttgctct
ctctcttctc ctcctcaccg ccgcaactcg gagcctcttg tctgctcaag gaattcactt ctatttcctt ctctttcagg
gggtatcatt cctttttgtt ggcctcgatc taattggaga acagatagac tgatCACTCT CAGGCTTTTG TCAAAACATA
GAAAGCATGC CTCTCTTCGT ACACACACTG GTAATCAAGT TCTGAGAGTT CCAAACATGC CATGGAATTT TACTTCATTT
TGGACAAGTT ACTTGTCCGT ACAGATATGC AAAGGAGAAT TTGTTCTGCA ATCCAGATTC AGGGCACAAA ACCGGAGTGA
TCCAACAGGA ATAAGCTGAA AGAGTAGATA GAATTCGTTC ATTTGTACCC AGTCCATATA GAGTTCCAGC AATGTTCTTT
GGATCCAAAA AATACTGAGA TGTGTGCTGT TCATTTGTAA ATCGTTAATA CACAATTTGT TCTGATAAAA TTATCAATTT
GTATATATTC CTACTTTAGA TAATGAAAAT GTTT

Locus: Os09g0428000

Loading...

Locus: Os09g0428000

Loading...