Os09t0439200-01

Locus

Os09g0439200

Description

Jasmonate ZIM-domain protein, Jasmonate-induced resistance to bacterial blight, Repressor of jasmonic acid signaling

RAP-DB Gene Symbol Synonym(s)

TIFY10C, OsJAZ7, OsJAZ 8, OsJAZ8, Os-JAZ8, JAZ8, OsTIFY10c, OsTIFY10c/OsJAZ8

RAP-DB Gene Name Synonym(s)

TIFY GENE 10C, Jasmonate ZIM-domain protein 7, Jasmonate ZIM-domain protein 8

CGSNL Gene Symbol

TIFY10C

CGSNL Gene Name

TIFY GENE 10C

Oryzabase Gene Symbol Synonym(s)

OsJAZ7, JAZ7, OsJAZ 8, OsJAZ8, Os-JAZ8, JAZ8, OsTIFY10c, OsTIFY10c/OsJAZ8

Oryzabase Gene Name Synonym(s)

Jasmonate ZIM-domain protein 7, Jasmonate ZIM-domain protein 8.

Transcript Evidence

AK108738

Protein Evidence

Q69P94

Literature

PMID: 23104764

Note

Manual Curation

December 15, 2014

Functional domain (InterPro)

Tify (IPR010399)

CO/COL/TOC1, conserved site (IPR018467)

Full-length cDNA

002-150-D12 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0439200-01)

Others

Oryzabase (9493)

KEGG (Os09t0439200-01)

Transcript

1178 bp

>Os09t0439200-01 Jasmonate ZIM-domain protein, Jasmonate-induced resistance to bacterial blight, Repressor of jasmonic acid signaling
AGAGAGAGACAACCAGACGGGAGCTTGTCGGGGAGGAGAGAGAGAGAGAGTGGTGGTGGT
GGTGGTGAGATGGCCGGCCGTGCGACGGCGACGGCGACGGCGGCGGGGAAGGACAGGTCC
AGCTTCGCCGTCACCTGTAGCCTCCTCAGCCAGTTTCTCAAGGAGAAGAAGGGCGGCGGC
GGCGGGCTGCAGGGGCTCGGCCTCGGCTTGCGGCCGGCGCCGGCGGCGCCGCCCGCCGCG
GGAGCTGGAGGTGCTTTCCGGCCGCCGCCGACCACCATGAACTTGCTGTCGGGGCTCGAC
GCGCCGGCGGTGGAGGTGGAGCCAAACACGGCGGAAACAGCGGCCGACGAGCTGCCTCTC
ATCAAGGCCCCGGCCGATCAGCAAAGCGACGAAAGTGCAAGTGAGGCAGCTGGAGAGAAG
GCTCAACAGCTGACCATCTTCTACGGTGGAAAAGTAGTCGTCTTTGAGAACTTCCCGTCC
ACCAAGGTCAAGGATCTCTTACAAATCGTAAGCACAGGCGATGGCGTCGACAAGAACACC
GGCACCGCGGCAACGCAGAGCCTGCCCCGACCCGCACACAACAGTCTTCCCGATCTGCCG
ATTGCAAGGAGGAACTCGCTCCATAGGTTTCTCGAGAAGAGAAAGGGCAGGATGAATGCA
AATGCTCCATACCAAGCTAACTGCACCGCTGCACCGTCCAAGCAAGCTAACGGTGACAAA
TCTTGGCTTGGGTTTGGCCAAGAGATGACAATAAAGCAGGAGATATGATATGACCTCTTA
GCTTACAGTTCACTGTCAAGTGTCAAGTGATCTGTGGGGAAGAGATGCGTGGTTGGCTGG
TTGCTAGTGCTAGTGTATTCCCCCGTAGCTTCAAAGCATGAATAATTACTCAATACTACT
ACATTACTACTAGTAAGAACTTAATCAATACTAGGAATCAAGCTGGTGGTTAATTCTGCC
TGACCATTGGCATCCTGGAATATATATAAGCACACACACGGGTTGTTTGTTCTCCACATT
GTTTGCTGCTGGAGCCGTATGCTCACTGCAGTTTATATCTGTCTAGCTGGTTACCCACCT
CAGCCTCACCATGTTTCGGGAATAAACACTGTGTATGTGCAAATTCTTCATTTCTCGTTC
GGTTTCGCCGTATAAATTACATTGTTACTATTTTGGCT

CDS

699 bp

>Os09t0439200-01 Jasmonate ZIM-domain protein, Jasmonate-induced resistance to bacterial blight, Repressor of jasmonic acid signaling
ATGGCCGGCCGTGCGACGGCGACGGCGACGGCGGCGGGGAAGGACAGGTCCAGCTTCGCC
GTCACCTGTAGCCTCCTCAGCCAGTTTCTCAAGGAGAAGAAGGGCGGCGGCGGCGGGCTG
CAGGGGCTCGGCCTCGGCTTGCGGCCGGCGCCGGCGGCGCCGCCCGCCGCGGGAGCTGGA
GGTGCTTTCCGGCCGCCGCCGACCACCATGAACTTGCTGTCGGGGCTCGACGCGCCGGCG
GTGGAGGTGGAGCCAAACACGGCGGAAACAGCGGCCGACGAGCTGCCTCTCATCAAGGCC
CCGGCCGATCAGCAAAGCGACGAAAGTGCAAGTGAGGCAGCTGGAGAGAAGGCTCAACAG
CTGACCATCTTCTACGGTGGAAAAGTAGTCGTCTTTGAGAACTTCCCGTCCACCAAGGTC
AAGGATCTCTTACAAATCGTAAGCACAGGCGATGGCGTCGACAAGAACACCGGCACCGCG
GCAACGCAGAGCCTGCCCCGACCCGCACACAACAGTCTTCCCGATCTGCCGATTGCAAGG
AGGAACTCGCTCCATAGGTTTCTCGAGAAGAGAAAGGGCAGGATGAATGCAAATGCTCCA
TACCAAGCTAACTGCACCGCTGCACCGTCCAAGCAAGCTAACGGTGACAAATCTTGGCTT
GGGTTTGGCCAAGAGATGACAATAAAGCAGGAGATATGA

Protein

232 aa

>Os09t0439200-01 Jasmonate ZIM-domain protein, Jasmonate-induced resistance to bacterial blight, Repressor of jasmonic acid signaling
MAGRATATATAAGKDRSSFAVTCSLLSQFLKEKKGGGGGLQGLGLGLRPAPAAPPAAGAG
GAFRPPPTTMNLLSGLDAPAVEVEPNTAETAADELPLIKAPADQQSDESASEAAGEKAQQ
LTIFYGGKVVVFENFPSTKVKDLLQIVSTGDGVDKNTGTAATQSLPRPAHNSLPDLPIAR
RNSLHRFLEKRKGRMNANAPYQANCTAAPSKQANGDKSWLGFGQEMTIKQEI*

5'UTR

chr09:16275200..16275268 (- strand) : 69 bp

CDS

chr09:16275019..16275199 (- strand) : 181 bp

chr09:16274782..16274932 (- strand) : 151 bp

chr09:16274371..16274561 (- strand) : 191 bp

chr09:16274167..16274224 (- strand) : 58 bp

chr09:16273932..16274049 (- strand) : 118 bp

3'UTR

chr09:16273522..16273931 (- strand) : 410 bp

FASTA

>Os09t0439200-01 class=Sequence position=chr09:16273522..16275268 (- strand)
AGAGAGAGAC AACCAGACGG GAGCTTGTCG GGGAGGAGAG AGAGAGAGAG TGGTGGTGGT GGTGGTGAGA TGGCCGGCCG
TGCGACGGCG ACGGCGACGG CGGCGGGGAA GGACAGGTCC AGCTTCGCCG TCACCTGTAG CCTCCTCAGC CAGTTTCTCA
AGGAGAAGAA GGGCGGCGGC GGCGGGCTGC AGGGGCTCGG CCTCGGCTTG CGGCCGGCGC CGGCGGCGCC GCCCGCCGCG
GGAGCTGGAG GTAATAAGCG ATTGTGTTCG TCATGCGATT AAATTAGCAG CGACTTGTTT TGTTTCTTAC CACGTATGGG
GTGTTGGTCT TTGCAGGTGC TTTCCGGCCG CCGCCGACCA CCATGAACTT GCTGTCGGGG CTCGACGCGC CGGCGGTGGA
GGTGGAGCCA AACACGGCGG AAACAGCGGC CGACGAGCTG CCTCTCATCA AGGCCCCGGC CGATCAGCAA AGCGACGAAA
GTGCAAGGTA CAAACAATCT CTAGTACACT CTGCATCCTG ACATCTCACG ATCTCAAACA AACTCTCTCC TGTTCATTAA
AAAAGAGTAG TAAAATGAAC ATAAAACATG TTATCCTGAC TTGCAACTTG CATCCTTATA CAATGTCTAG AAGAAGAAGA
AAACACACTT AATTTTTTGG AGTAGAGATA ATTTGGTTGC AACTGTCTCT TTGGTTCTTT CTTCCAGTGA GGCAGCTGGA
GAGAAGGCTC AACAGCTGAC CATCTTCTAC GGTGGAAAAG TAGTCGTCTT TGAGAACTTC CCGTCCACCA AGGTCAAGGA
TCTCTTACAA ATCGTAAGCA CAGGCGATGG CGTCGACAAG AACACCGGCA CCGCGGCAAC GCAGAGCCTG CCCCGACCCG
CACACAACAG TCTTCCCGGT AATAACAACT GTTCATTCTT TTGCAGTTTT ACATTTTACC ATCACAGTGC TAATTAATTT
CCATCTACTA TGCTTAAATT TATCTACTAC ATGTGAAACA ATGTAGGAAT CCTTAACGAA TGACTGATTT TTGATTTGTT
ACAGATCTGC CGATTGCAAG GAGGAACTCG CTCCATAGGT TTCTCGAGAA GAGAAAGGGC AGGTAGGTAA CTGAGTGGCT
TTCAACTTCT ATCTGAAATA CTTGCCTTTC GCTGTCAAAA ACTGGCTGTC AGACCAAGTT TATGGCCCTA AAATTCTCCA
TGCTCTTCAA CCACTCCAGG ATGAATGCAA ATGCTCCATA CCAAGCTAAC TGCACCGCTG CACCGTCCAA GCAAGCTAAC
GGTGACAAAT CTTGGCTTGG GTTTGGCCAA GAGATGACAA TAAAGCAGGA GATATGATAT GACCTCTTAG CTTACAGTTC
ACTGTCAAGT GTCAAGTGAT CTGTGGGGAA GAGATGCGTG GTTGGCTGGT TGCTAGTGCT AGTGTATTCC CCCGTAGCTT
CAAAGCATGA ATAATTACTC AATACTACTA CATTACTACT AGTAAGAACT TAATCAATAC TAGGAATCAA GCTGGTGGTT
AATTCTGCCT GACCATTGGC ATCCTGGAAT ATATATAAGC ACACACACGG GTTGTTTGTT CTCCACATTG TTTGCTGCTG
GAGCCGTATG CTCACTGCAG TTTATATCTG TCTAGCTGGT TACCCACCTC AGCCTCACCA TGTTTCGGGA ATAAACACTG
TGTATGTGCA AATTCTTCAT TTCTCGTTCG GTTTCGCCGT ATAAATTACA TTGTTACTAT TTTGGCT

Locus: Os09g0439200

Loading...

Locus: Os09g0439200

Loading...