Os09t0439800-01

Locus

Os09g0439800

Description

Control of root system architecture, Drought avoidance

RAP-DB Gene Symbol Synonym(s)

DRO1, Dro1

RAP-DB Gene Name Synonym(s)

DEEPER ROOTING 1, Deeper rooting 1

CGSNL Gene Symbol

DRO1

CGSNL Gene Name

DEEPER ROOTING 1

Oryzabase Gene Symbol Synonym(s)

Dro1, OsDRO1, OsSPR1, SPR1

Oryzabase Gene Name Synonym(s)

Deeper rooting 1, Short postembryonic roots 1

Transcript Evidence

AK068870

AB689741 (Kinandang Patong)

Protein Evidence

Q69P88

Literature

PMID: 23913002

Note

Manual Curation

July 1, 2016

Full-length cDNA

J023002M06 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0439800-01)

RiceXPro (AK068870)

Others

Oryzabase (8892)

KEGG (Os09t0439800-01)

Transcript

1282 bp

>Os09t0439800-01 Control of root system architecture, Drought avoidance
AGATGAAGTATAGCAAGCTATCCTACAGCCAGCCACGCTGCACCGAACCCTCCAATCCTT
GGAACTTGAACCCCTTCAAATCACACCCAGTAGGCTACTAGTAGTACTTCTCTGCACCAA
TTCCATCGCCAATAGCAGCCACTACAAGTCTTACATCTCTCCTTTCCTCCTCTCTCTGCC
ATTGCTAGGAGCTTGCATTTCTTGGTAGCTTCATCAGCTAGCTGCTTTCTCCCTCCCCAA
TCTCTCATTCTTCAGGCCAGGATATGAAGATTTTCAGCTGGGTAGCCAACAAGATCAGTG
GGAAGCAAGAAGCAAATCGGTTTCCCGCAAATTCTTCTGCGCCTTACCGTGCTAACGTGT
CAGATTGTCGAAAGGATGAATTCAGTGATTGGCCCCAATCATTGCTTGCTATTGGGACAT
TTGGAAATAAGCAGATTGAGGAGGTAGCTCAGGTGGAGAATTCATCCGACAATGTGCAGT
CAGTGCAAGATACCGTCAAATTTACAGAGGAAGAAGTAGACAAGATACGGAAAGAATTCG
AAACGCTACTAGCAATCAAAGATCAAGCAGAAGCTCAACGCTCGCATGATGATGACCAAG
TAGGTTTACAAAAGCGTGCCGATGGGGAAGACAATGAGAAGCATATTAGACAGTTGATCA
ACAAAAGGATCATTGTAAGTAAATCAAAGAATTCGTTAGGAAAGAAAGGAAATACACTCA
AGCCGAGATCAGTCGCTTCGTTGCTCAAGTTATTCATGTGTAAGGGTGGCTTTACCTCCG
TAGTTCCAGAACCAAGGAACACATTTCCTCAATCAAGAATGGAGAAGTTGCTCAAGGCAA
TATTGCAGAAGAAAATACACCCGCAAAATTCTTCCACGCTAGTTGCTAAGAGGCATTTGG
ACTGGAAGCCAGATGAGACAGAAATCAATGAGTGCCTGGAGGATGCACTGCGTGATCTAG
ACGATGATGGTGCAAAATGGGTCAAAACTGATTCAGAGTATATTGTGCTTGAAATGTAAA
GTTGGGTGAATATGTTAGTTCGTTCATGCCAGGTTCCAAAGGTCCTGGCAAGCTTGGGGT
TTATGGTGTTACTACGTAATGATATAAATATGGGATATAGTTAGCAATGAAGCTCTATGA
TCATGTAATGCTCCTCCATTATTTCTGACATGAACCATCTGTAATTTGAATCATGATAAG
GAGGTTCTGGGACAAAGGCCTATTCCATGTGTCTACTCTCTTCTGCCCTGAAACTGTAAA
GAACGCATTCAATTTTTTCAAC

CDS

756 bp

>Os09t0439800-01 Control of root system architecture, Drought avoidance
ATGAAGATTTTCAGCTGGGTAGCCAACAAGATCAGTGGGAAGCAAGAAGCAAATCGGTTT
CCCGCAAATTCTTCTGCGCCTTACCGTGCTAACGTGTCAGATTGTCGAAAGGATGAATTC
AGTGATTGGCCCCAATCATTGCTTGCTATTGGGACATTTGGAAATAAGCAGATTGAGGAG
GTAGCTCAGGTGGAGAATTCATCCGACAATGTGCAGTCAGTGCAAGATACCGTCAAATTT
ACAGAGGAAGAAGTAGACAAGATACGGAAAGAATTCGAAACGCTACTAGCAATCAAAGAT
CAAGCAGAAGCTCAACGCTCGCATGATGATGACCAAGTAGGTTTACAAAAGCGTGCCGAT
GGGGAAGACAATGAGAAGCATATTAGACAGTTGATCAACAAAAGGATCATTGTAAGTAAA
TCAAAGAATTCGTTAGGAAAGAAAGGAAATACACTCAAGCCGAGATCAGTCGCTTCGTTG
CTCAAGTTATTCATGTGTAAGGGTGGCTTTACCTCCGTAGTTCCAGAACCAAGGAACACA
TTTCCTCAATCAAGAATGGAGAAGTTGCTCAAGGCAATATTGCAGAAGAAAATACACCCG
CAAAATTCTTCCACGCTAGTTGCTAAGAGGCATTTGGACTGGAAGCCAGATGAGACAGAA
ATCAATGAGTGCCTGGAGGATGCACTGCGTGATCTAGACGATGATGGTGCAAAATGGGTC
AAAACTGATTCAGAGTATATTGTGCTTGAAATGTAA

Protein

252 aa

>Os09t0439800-01 Control of root system architecture, Drought avoidance
MKIFSWVANKISGKQEANRFPANSSAPYRANVSDCRKDEFSDWPQSLLAIGTFGNKQIEE
VAQVENSSDNVQSVQDTVKFTEEEVDKIRKEFETLLAIKDQAEAQRSHDDDQVGLQKRAD
GEDNEKHIRQLINKRIIVSKSKNSLGKKGNTLKPRSVASLLKLFMCKGGFTSVVPEPRNT
FPQSRMEKLLKAILQKKIHPQNSSTLVAKRHLDWKPDETEINECLEDALRDLDDDGAKWV
KTDSEYIVLEM*

5'UTR

chr09:16310575..16310837 (- strand) : 263 bp

CDS

chr09:16310569..16310574 (- strand) : 6 bp

chr09:16310374..16310452 (- strand) : 79 bp

chr09:16308532..16309010 (- strand) : 479 bp

chr09:16308269..16308440 (- strand) : 172 bp

chr09:16308153..16308172 (- strand) : 20 bp

3'UTR

chr09:16308120..16308152 (- strand) : 33 bp

chr09:16307780..16308009 (- strand) : 230 bp

FASTA

>Os09t0439800-01 class=Sequence position=chr09:16307780..16310837 (- strand)
AGATGAAGTA TAGCAAGCTA TCCTACAGCC AGCCACGCTG CACCGAACCC TCCAATCCTT GGAACTTGAA CCCCTTCAAA
TCACACCCAG TAGGCTACTA GTAGTACTTC TCTGCACCAA TTCCATCGCC AATAGCAGCC ACTACAAGTC TTACATCTCT
CCTTTCCTCC TCTCTCTGCC ATTGCTAGGA GCTTGCATTT CTTGGTAGCT TCATCAGCTA GCTGCTTTCT CCCTCCCCAA
TCTCTCATTC TTCAGGCCAG GATATGAAGG TAAAGGCTCA AACCATCGGT GTGATTAATC ATTTCAGAGA GGTTAATAGA
TTTGAAGTGT TGGTAGTGTT GATCCATTTC TTGATGGCAT CATGAGGCTT GGGTTTTCTC TGCAGATTTT CAGCTGGGTA
GCCAACAAGA TCAGTGGGAA GCAAGAAGCA AATCGGTTTC CCGCAAATTC TTCTGCGCCT TACCGTGAGT GTACCTGAAC
TTTCAGTTTC CTTGTAAATT CTTTCAGAAC TAAGGTGATT GTTGTTCACC AGGCTTCATG CTGTTCTTAT GAAATGTTTC
CCTGTTCCTT GAGGGGAGAG GGAGAGTACG GACAGTAATT TGGAAGCCGT TTCCTAATTT GATATTTTCT TTCTGTCATT
CTGCTGCAGT TATAATGTCT TTACCTCTTA GCAGTTTCTG CTTAGGCATC ATTTGCCTTA TTCATTTCTG GATACGATGA
TACTTTATTG CTTTGTCCTA ATTTAATCTT TTCCTGCTGT CATTCTGCTC CATTTATGGT GTCTTTACCT CTTAGCAGTT
TCCGCTTAGG CATCATTTGC CATGTTCATT TCTGAATATG CTGATATACT TTGTTGTCTT GGTAGCCATA TACAAGAGTG
AACGATTTAA AGGTTTCTCC TAATTGCTAG TAACAGAACG CTTTTCGCTC TGCGATTTTC TGGATTACCA TCCCCTGATT
CCTGAGTAAC CTATCACAAC GCCAATGTGA TGGAGCAAAC ATTGATGTAT TATGACAATG TTGTTTCTGA TCCTTTGAGA
AAATTTTCTT ATATGCACTT GGGTGTTGTT TGGAACGCAG GAATTTCACT GGAAACAGTT CAATTATCGC ACTTCCGGAA
AAAAAATTCC TGCATTTTAA ACGGCGCTTT AAGTTCAGTA GGAGTTTTCA ATTTTATTTT CCTCTTCCCT AGCACGAAAA
GTGAGAGATT TTTGTGCATA TGTTATACCC CCAAAGGACT ATTTCATGGC CTGATGCCCG CCACGCCAAT ATCTCTGTAA
AGCACTGCTT CCAACTAGTC AGTATGGGTC AAAGTCTTGA CTAAGTGCAA CCCTGCAAGC AAGTGTTTCC AACTAGTCAG
TATGGCTTCA ATTATTTAGT TGATTTATAA CCCCAACCCT CCACTTGTGA CCAAGAAGAA TTTGATTTGA GCAGACAATA
TCCTGACCTC GGATGGTTTC GTAAATCGTA CTAAGGAATC AGATCTGAGC CACTAGTCCA GCTGGACTAC AGTACATTAT
TTATCTCTCA AGATTACATA AAAAGACTAC TATTGTACAG AGAATGCATT GTTTAAGTGG TAACAACTGC TGTGATAAGT
TATTCCTGGT ATACAGAAAA ATGGCAGGTG AAAACATCAG GGAGTGGAGT AAGCATGGGC AGACATTGTA CTTAAAGAGT
GATAGGCCAA TGAGAATCAC TGGGTGTTTA AGGATTAAAA ATTTGTGGTC CATGCTCTAG ACATCCAATT TATGCTAATA
TGAACTTAGG ACCATATATT TATGTTTGTT TACTGATCTT GCGGCTTAAT CGAGTTCTAA TGCGCAGGTG CTAACGTGTC
AGATTGTCGA AAGGATGAAT TCAGTGATTG GCCCCAATCA TTGCTTGCTA TTGGGACATT TGGAAATAAG CAGATTGAGG
AGGTAGCTCA GGTGGAGAAT TCATCCGACA ATGTGCAGTC AGTGCAAGAT ACCGTCAAAT TTACAGAGGA AGAAGTAGAC
AAGATACGGA AAGAATTCGA AACGCTACTA GCAATCAAAG ATCAAGCAGA AGCTCAACGC TCGCATGATG ATGACCAAGT
AGGTTTACAA AAGCGTGCCG ATGGGGAAGA CAATGAGAAG CATATTAGAC AGTTGATCAA CAAAAGGATC ATTGTAAGTA
AATCAAAGAA TTCGTTAGGA AAGAAAGGAA ATACACTCAA GCCGAGATCA GTCGCTTCGT TGCTCAAGTT ATTCATGTGT
AAGGGTGGCT TTACCTCCGT AGTTCCAGAA CCAAGGAACA CATTTCCTCA ATCAAGAATG GAGAAGGTAC ACAGTGAAAT
TCTTTTTTTC TTATGTAACA TGATAAGTTT TACATACTTT CTCGTCCTCT TATTATCTTA TATGATGTTC ATTGCAGTTG
CTCAAGGCAA TATTGCAGAA GAAAATACAC CCGCAAAATT CTTCCACGCT AGTTGCTAAG AGGCATTTGG ACTGGAAGCC
AGATGAGACA GAAATCAATG AGTGCCTGGA GGATGCACTG CGTGATCTAG ACGATGATGG TGCAAAATGG GTCAAAACTG
ATTCAGAGTG TAAGTAGCAT ACTTGCCTAT CATGAATTGA ACCTTTTCTT TTGCCACTTT TGTCAATGGA GCAACTGACT
GAATATGAAC TTTTCTTGTT TCCAGATATT GTGCTTGAAA TGTAAAGTTG GGTGAATATG TTAGTTCGTT CATGCCAGGT
ATATACCTTT CTTTGATCCC CAAATTTTCA ACTCAACTCA AATGTGAATT ATCCTTGATC TAGCATGTCT CTCTGTTTTG
ATCTGATTAG TGTGATTCCA ATCTGCAGGT TCCAAAGGTC CTGGCAAGCT TGGGGTTTAT GGTGTTACTA CGTAATGATA
TAAATATGGG ATATAGTTAG CAATGAAGCT CTATGATCAT GTAATGCTCC TCCATTATTT CTGACATGAA CCATCTGTAA
TTTGAATCAT GATAAGGAGG TTCTGGGACA AAGGCCTATT CCATGTGTCT ACTCTCTTCT GCCCTGAAAC TGTAAAGAAC
GCATTCAATT TTTTCAAC