Os09t0440300-02

Locus

Os09g0440300

Description

Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH7

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 7

Oryzabase Gene Symbol Synonym(s)

OsALDH7, osaldh7, LDH, ALDH7B7, OsALDH7B6, ALDH7B6

Oryzabase Gene Name Synonym(s)

Oryza sativa Aldehyde Dehydrogenase 7, Family 7 ALDH, lactic acid dehydrogenase, Aldehyde Dehydrogenase 7B6

Transcript Evidence

AK120185 (DDBJ, Best hit)

AK060757 (DDBJ, Best hit)

Protein Evidence

Q9FPK6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J013034F13 (Online Clone Ordering)

001-032-H04 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0440300-02)

RiceXPro (AK120185)

Others

Oryzabase (8278)

KEGG (Os09t0440300-02 (EC:1.2.1.3))

Transcript

1975 bp

>Os09t0440300-02 Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).
ACAGCCACCGCCTCCCCCACCCCACCCCGATCCCCTCCCCGCCGTACGGGCGCAGAAGGA
ACCCGTCTTCTAGAAGGAGGAGGAGGGCTACCTCTCTCTCTCTCTCTTCTGCCATGGGGA
GCTTCGCGAGGAAGGAGCACCAGTTCCTCGCCGAGCTTGGCCTCGCGCCGCGGAACCCCG
GGTCCTTCGCCTGCGGCGCCTGGGGCGGCTCGGGCCCCGTCGTCACGTCCACCAACCCGA
CGAACAACCAGGTCATCGCGGAGGTCGTGGAGGCGTCCGCGCGTGAGTACGAGGAGGGCA
TGCGCGCCTGCTACGATGCCGCCAAGACCTGGATGGCGATTCCAGCTCCAAAGCGAGGAG
AAATTGTTAGGCAAATTGGTGATGCATTGAGAGCAAAGCTCCATCACCTGGGCAGGCTTG
TGTCACTTGAGATGGGGAAAATTCTTCCTGAAGGGATTGGAGAGGTTCAGGAAATCATTG
ACATGTGTGATTATGCTGTGGGCCTAAGTCGCCAGCTAAATGGGTCCATCATACCATCTG
AACGCCCGAATCATATGATGATGGAGGTGTGGAATCCTCTTGGAGTTGTTGGTGTTATCA
CAGCATTCAATTTTCCTTGTGCTGTGCTGGGTTGGAATGCCTGCATAGCTTTGGTATGTG
GAAACTGTGTTGTCTGGAAAGGTGCTCCAACTACTCCGTTGATCACTATTGCAATGACTA
AAATAGTTGCCAGTGTATTGGAGAGGAACAACTTGCCAGGCTCAATTTTTACAGCATTCT
GTGGTGGTGCTGACATTGGCCAAGCAATTTCTCTTGACACAAGGATACCCTTGGTTTCAT
TCACAGGAAGCACAAAGGTTGGTCTAATGGTTCAGCAGCAAGTGAATGCAAGATTTGGCA
AATGCCTTCTTGAACTTAGTGGGAACAATGCCATTATTGTAATGGATGATGCAGACATTC
AGCTAGCTGTCCGTTCAGTGTTGTTTGCTGCTGTTGGAACAGCAGGACAACGCTGCACTA
CATGTCGTAGGCTGCTTCTTCACGAAAGCATATACCGAACATTTCTTGATCAACTTGTTG
AGGTTTATAAACAAGTCCGAATTGGGGATCCTTTGGAGAATGGTACGTTACTGGGGCCAT
TGCACACTCCTGCTTCAAGAGACGCCTTCTTGAAAGGCATCCAAACCATCAGATCTCAGG
GGGGAAAAATTCTTTATGGAGGATCTGCAATTGAATCTGAGGGAAACTTTGTTCAGCCAA
CAATTGTGGAAATTTCACCCTCTGCACCGGTTGTGAGAGAAGAACTCTTTGGTCCTGTTC
TTTATGTGATGAAAGTTCAGAATCTGAAGGAAGCAGTTGAAATCAACAATTCTGTTCCTC
AAGGATTGAGCAGTTCTATATTTACAAAGAGACCAGATATTATTTTCAAGTGGATTGGGC
CTCATGGTAGTGACTGTGGCATTGTTAATGTAAATATTCCCACAAATGGTGCTGAAATTG
GTGGAGCTTTTGGTGGAGAAAAAGCTACTGGTGGTGGACGAGAAGCAGGGAGTGATTCGT
GGAAGCAGTACATGAGGAGGGCCACTTGTACGATCAACTATGGAAGCGAGCTGCCTCTAG
CACAAGGAATAAATTTTGGCTAGTTCGGTGGTCAAGATCGGCTGATGAACATGTTAAGCT
TCATCGACAGACTTCAGGAATTTCTACTGGCGTCAACTGAAAACCGAAACTTCAACGCAG
CAGCATTGCTATGTGTGCATATAATAAGAGATGAGTCCAATATTAATGCATGTACTGCTC
TTGCTATGATTAGCCGTCGGAGTTCGAGTCCAATAAACAGGGAAAAATTGCGTATTCCCT
GATCGGTTGATATGTACCAACATTTCTGATGTAATCTTTAGAACGGTATCGGTTGAAAAC
TTGAAATGAACGAAAACGCGGTAAGAATACAAAATGGTGTGCAAACCTTCAGGCT

CDS

1530 bp

>Os09t0440300-02 Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).
ATGGGGAGCTTCGCGAGGAAGGAGCACCAGTTCCTCGCCGAGCTTGGCCTCGCGCCGCGG
AACCCCGGGTCCTTCGCCTGCGGCGCCTGGGGCGGCTCGGGCCCCGTCGTCACGTCCACC
AACCCGACGAACAACCAGGTCATCGCGGAGGTCGTGGAGGCGTCCGCGCGTGAGTACGAG
GAGGGCATGCGCGCCTGCTACGATGCCGCCAAGACCTGGATGGCGATTCCAGCTCCAAAG
CGAGGAGAAATTGTTAGGCAAATTGGTGATGCATTGAGAGCAAAGCTCCATCACCTGGGC
AGGCTTGTGTCACTTGAGATGGGGAAAATTCTTCCTGAAGGGATTGGAGAGGTTCAGGAA
ATCATTGACATGTGTGATTATGCTGTGGGCCTAAGTCGCCAGCTAAATGGGTCCATCATA
CCATCTGAACGCCCGAATCATATGATGATGGAGGTGTGGAATCCTCTTGGAGTTGTTGGT
GTTATCACAGCATTCAATTTTCCTTGTGCTGTGCTGGGTTGGAATGCCTGCATAGCTTTG
GTATGTGGAAACTGTGTTGTCTGGAAAGGTGCTCCAACTACTCCGTTGATCACTATTGCA
ATGACTAAAATAGTTGCCAGTGTATTGGAGAGGAACAACTTGCCAGGCTCAATTTTTACA
GCATTCTGTGGTGGTGCTGACATTGGCCAAGCAATTTCTCTTGACACAAGGATACCCTTG
GTTTCATTCACAGGAAGCACAAAGGTTGGTCTAATGGTTCAGCAGCAAGTGAATGCAAGA
TTTGGCAAATGCCTTCTTGAACTTAGTGGGAACAATGCCATTATTGTAATGGATGATGCA
GACATTCAGCTAGCTGTCCGTTCAGTGTTGTTTGCTGCTGTTGGAACAGCAGGACAACGC
TGCACTACATGTCGTAGGCTGCTTCTTCACGAAAGCATATACCGAACATTTCTTGATCAA
CTTGTTGAGGTTTATAAACAAGTCCGAATTGGGGATCCTTTGGAGAATGGTACGTTACTG
GGGCCATTGCACACTCCTGCTTCAAGAGACGCCTTCTTGAAAGGCATCCAAACCATCAGA
TCTCAGGGGGGAAAAATTCTTTATGGAGGATCTGCAATTGAATCTGAGGGAAACTTTGTT
CAGCCAACAATTGTGGAAATTTCACCCTCTGCACCGGTTGTGAGAGAAGAACTCTTTGGT
CCTGTTCTTTATGTGATGAAAGTTCAGAATCTGAAGGAAGCAGTTGAAATCAACAATTCT
GTTCCTCAAGGATTGAGCAGTTCTATATTTACAAAGAGACCAGATATTATTTTCAAGTGG
ATTGGGCCTCATGGTAGTGACTGTGGCATTGTTAATGTAAATATTCCCACAAATGGTGCT
GAAATTGGTGGAGCTTTTGGTGGAGAAAAAGCTACTGGTGGTGGACGAGAAGCAGGGAGT
GATTCGTGGAAGCAGTACATGAGGAGGGCCACTTGTACGATCAACTATGGAAGCGAGCTG
CCTCTAGCACAAGGAATAAATTTTGGCTAG

Protein

510 aa

>Os09t0440300-02 Similar to Aldehyde dehydrogenase family 7 member A1 (EC 1.2.1.3) (Antiquitin 1) (Matured fruit 60 kDa protein) (MF-60).
MGSFARKEHQFLAELGLAPRNPGSFACGAWGGSGPVVTSTNPTNNQVIAEVVEASAREYE
EGMRACYDAAKTWMAIPAPKRGEIVRQIGDALRAKLHHLGRLVSLEMGKILPEGIGEVQE
IIDMCDYAVGLSRQLNGSIIPSERPNHMMMEVWNPLGVVGVITAFNFPCAVLGWNACIAL
VCGNCVVWKGAPTTPLITIAMTKIVASVLERNNLPGSIFTAFCGGADIGQAISLDTRIPL
VSFTGSTKVGLMVQQQVNARFGKCLLELSGNNAIIVMDDADIQLAVRSVLFAAVGTAGQR
CTTCRRLLLHESIYRTFLDQLVEVYKQVRIGDPLENGTLLGPLHTPASRDAFLKGIQTIR
SQGGKILYGGSAIESEGNFVQPTIVEISPSAPVVREELFGPVLYVMKVQNLKEAVEINNS
VPQGLSSSIFTKRPDIIFKWIGPHGSDCGIVNVNIPTNGAEIGGAFGGEKATGGGREAGS
DSWKQYMRRATCTINYGSELPLAQGINFG*

5'UTR

chr09:16338352..16338464 (- strand) : 113 bp

CDS

chr09:16338213..16338351 (- strand) : 139 bp

chr09:16337994..16338079 (- strand) : 86 bp

chr09:16337061..16337192 (- strand) : 132 bp

chr09:16336615..16336687 (- strand) : 73 bp

chr09:16335982..16336004 (- strand) : 23 bp

chr09:16335829..16335892 (- strand) : 64 bp

chr09:16335435..16335480 (- strand) : 46 bp

chr09:16334981..16335161 (- strand) : 181 bp

chr09:16334592..16334768 (- strand) : 177 bp

chr09:16334352..16334516 (- strand) : 165 bp

chr09:16333741..16333881 (- strand) : 141 bp

chr09:16333524..16333621 (- strand) : 98 bp

chr09:16332791..16332940 (- strand) : 150 bp

chr09:16330436..16330490 (- strand) : 55 bp

3'UTR

chr09:16330104..16330435 (- strand) : 332 bp

FASTA

>Os09t0440300-02 class=Sequence position=chr09:16330104..16338464 (- strand)
ACAGCCACCG CCTCCCCCAC CCCACCCCGA TCCCCTCCCC GCCGTACGGG CGCAGAAGGA ACCCGTCTTC TAGAAGGAGG
AGGAGGGCTA CCTCTCTCTC TCTCTCTTCT GCCATGGGGA GCTTCGCGAG GAAGGAGCAC CAGTTCCTCG CCGAGCTTGG
CCTCGCGCCG CGGAACCCCG GGTCCTTCGC CTGCGGCGCC TGGGGCGGCT CGGGCCCCGT CGTCACGTCC ACCAACCCGA
CGAACAACCA GGCGCGTCTC CCCCCACACG ATCCGCTCGG TTCTAGGCGC TCGATTTGGT TTGGGCCGCC CTGGCATTTT
TGGGGTGTGT GTGATTGTGG TGGATTTTGA TGGGGGATTT TTTTTTGGGT GTTTTGTGGT TTAGGTCATC GCGGAGGTCG
TGGAGGCGTC CGCGCGTGAG TACGAGGAGG GCATGCGCGC CTGCTACGAT GCCGCCAAGA CCTGGATGGC GGTGAGTTTC
ACTTGACTTG CTGTGTTGGA GTGCTGATAT CAATTCGTTC GGATGATGAA GTGCTCGTAC TATGCTCTTG TGTGTCATTT
GCTATTTTCT GCTGCGTGAG AGATCTGACT GTGTGGAAAC CAGCAATTGT GCAATTCGAA ACGTTGCGAT ATTATTTGTT
TGGAAATGCT GCCTCAAAAC CCTGTAACTT GGGTGTTTTG GGGGTTTCAG CTTTTGGTTA CAGCCTTACA GGAATCTGAG
TCTGCTATAG CGCTCTAATG CAGCAAACAG TGTTCGGTAC TGTACCTAAT TTACTGTACA TGATAATCAT TACTGTAGCG
AAAGTGATGT AACAACTCAC CTTTACCATT AGTCCGTTAA TAAACGACAA GGATCAAGGG CTAATTCCTG GTACTATAGC
CCTATGCCGT AGCATGGTGC TACATCAGAG GATCTCCTTC CTTTGAGAAG GTGGTATGGA CTCGTTATAT GATTCAGGAA
CACCAAAAAT CTGATATAAA ATGGGAAATG GCAAAGTAAC AGTATGTCCG ATGTTAAAAT GCTGATAAAG TAGAGACTGT
GTGCAATGTG CACACTACGA TTTCATATTT CATACATGTT TTAATTTATA AGATTGTGAT ATCAAAATTT AATTAAAATA
CACATGTATG TATAAGCACA CTATGATGTA TAGAAGCTAG CAGCACTGTT ATGATGCAAA AATTCAAATA TGTGGAAGAA
GCGCAGCTGA GATCCCTTTT TTTAAGTTAT TTTATTGTAA AACTACTAAC AGTTACATAT TAATATGTCC AGATTCCAGC
TCCAAAGCGA GGAGAAATTG TTAGGCAAAT TGGTGATGCA TTGAGAGCAA AGCTCCATCA CCTGGGCAGG CTTGTGTCAC
TTGAGATGGG GAAAATTCTT CCTGAAGGGA TTGGAGAGGT TCAGGTAGGT ATAATTGCCG CCAGTTCTTC CACTCAGAGC
TTCATTGTTT TTTGCACTCA GGATAGGAAA TGACCACTAT ATTGTGTTTC TTCAGAATAT TCAGTGATTT ATCTTTAGAA
CATTAATGGT GTGCTCATCA CGAATGCTTC ATTATCATCA ATACCTTGCC TGCTAGAATT ACCAACTTAG CCCCTAACAT
GATATGCAGT TGTGTTTCCT TTTCTCTCTG TTAATCATCT TTCTGCCAAT CGAATGTCTT GCCTAAGAAT TTGGCCATTA
TTGAGATAAT TTCATGATCG AATATTTAAC TGCGACTATT GATTCTCCAC CATGAAGGCA TGATTATGTT GACATAAATG
TAACCTCTGT TTTGTAGGAA ATCATTGACA TGTGTGATTA TGCTGTGGGC CTAAGTCGCC AGCTAAATGG GTCCATCATA
CCATCTGAAC GTAAGCCCAT TCTCCCTTTC CTAATTTATA TCTGATGCCC GCTTCAAAGT ATGATAACAG CAGATACTTC
TGATCATATT TTCTCTATTT GGTTGAGATA CAAATATTAT TATATCTTAA TTCTGTCTGA AAAAGAATAC CTCAATTGAT
TTAGGTTTCC AGGTTTTCTA ATGAAATTAG TACTTCATTA GAATAAGCAA TTTTACTCCA TTATTACTAA TTCGCTCTCT
GGATTATTTC ATGTTAAGTG ATTCTCCATT TCACTAATTT GAACACACAA TATACTTGCC ATTCTAGTTT ACTGTTCTAT
ACAAAATCCT GTCCCTTGAC ATGCCATACC ACCATTACTT ATCAAAATGT GCCATCACAC GATTTTCTGT AGTAATGATA
AGATATTCGC TGATTGTCCG TTAGACAGCA ATATTTTACA GAGTTATGCC CAAATTATCA CCATTGGTTT TTGTGGTTAG
GATAGAAGGT TGAGCCATGG CGTTCTCAAT TGTAGTAATG TTGCCATTTA TTCATACTTA TGGGATTGTA AAATTCATCA
ATGCTCTGTT TGATAAGTAT ACTGGAAGAT TTTCTAATGC TGTCTTCTAC TTTTTTTCAG GCCCGAATCA TATGATGATG
GAGGTAGGCA CAAACCAGTT CTTTTAACTC CAGATTTACT TTCTCTGTTT CTCATGTGGA AGAAAGCTAA TCCCTAAAGC
TCATTCAAAT AGGTGTGGAA TCCTCTTGGA GTTGTTGGTG TTATCACAGC ATTCAATTTT CCTTGTGCTG TGCTGGGTAA
GTGTCTTCTC TTAGAATATC ATTAGTGAAA TCAACTTAGT GCATTGCAAT TCCCTGTTAT TTACCCCTAC ATACTCTTGA
TCTATCAAAT GCAAAATTGA CAAGAACTTG ACCTATTGAA AATTAACTGT TATAATCCAA TGAGTAGCCG TGTCCATATA
ATAGGATCTT CAAGGTGTCA ATTTAGCCGC TTACTCTTTT GTTTATGATA TACATGATAT GTTGCATGTT TATGCTATAA
TCTTTTGAAT GCTATGGTGC TGGCGACCTT TATCACATGC TCAAATTCTT GTAATCCTTA ACAGCGACTA ATACATCAAT
TATTTCCTTT TTGTCATATT TTAGGTTGGA ATGCCTGCAT AGCTTTGGTA TGTGGAAACT GTGTTGTCTG GTAAGAATGA
TTTCCTTTCT CCATAAACTG AAAGTACTGT CCTACTACAT GTTATCAGTA CTGTAACTTT CTTTACTTAT ATTATGGATG
AGAGTATGCT CTTAAGTTGT ATTCTCTGAA CATTTCAATA GATCATTAGC TTAGTGTTCC AGATTATAAT AATTTCGTAA
TGTTCATTAA ACTGGTGAAG GTCCATTATA TCTATTGCAT TTTCCTTGCA TGAACTGTCT TGGAACTGTC CTTTTTTTGT
AACTAATTTC TAAACAATTG CAGGAAAGGT GCTCCAACTA CTCCGTTGAT CACTATTGCA ATGACTAAAA TAGTTGCCAG
TGTATTGGAG AGGAACAACT TGCCAGGCTC AATTTTTACA GCATTCTGTG GTGGTGCTGA CATTGGCCAA GCAATTTCTC
TTGACACAAG GATACCCTTG GTTTCATTCA CAGGAAGCAC AAAGGTATAT ACTACAGTAA ACTGCTACCT ATGTCATCTA
TGCATATTTC CTAATCGATC CATTTTGATA TAATGACCTC CATCACATCT CCAATTTCTA TTTCCTTTTG AGGTCCTTTT
TTAATTCTGA GCAGCTTTTT CAAGCATTTG ATAATTATAT ATCATTGAAC TGTGCTGATC TACTGCAAAA TTTGTAACAC
TGATTGCTCA ATGCAGGTTG GTCTAATGGT TCAGCAGCAA GTGAATGCAA GATTTGGCAA ATGCCTTCTT GAACTTAGTG
GGAACAATGC CATTATTGTA ATGGATGATG CAGACATTCA GCTAGCTGTC CGTTCAGTGT TGTTTGCTGC TGTTGGAACA
GCAGGACAAC GCTGCACTAC ATGTCGTAGG CTGGTAAGAT AGGTTTTTCT TATCTGCCCC AATGGCTGGT GTATGAGTAG
TCTAAATGCT TTTGTTTTGT TAACACAGCT TCTTCACGAA AGCATATACC GAACATTTCT TGATCAACTT GTTGAGGTTT
ATAAACAAGT CCGAATTGGG GATCCTTTGG AGAATGGTAC GTTACTGGGG CCATTGCACA CTCCTGCTTC AAGAGACGCC
TTCTTGAAAG GCATCCAAAC CATCAGATCT CAGGTGATAT TATTGATGCA ACAACATTTG CTTGTGCATC AATGTCTGTT
TGCATTATAT TAAACAATCT TTACATCTTC AATACTTAAA ATGCTTAAGT TGGTAGTGTT GATGGCCTTT CTACTCCTCC
CTataatcta aataattctt aatatgttag cagtcaaagt tttcttaatt tgttggcagt agtcaaagtt aaagatgttt
gattgcatgc tttctacaaa attgtatttC TGAATGTATG GAGTTTATTA TTCCCTGAAT TCTGAATCTT GAATGTACAT
CTTAAAATGC TGTGCTACTG GAAGTTGTTA GTTCAGTATG TTTAACTAGA ATCAATCTCA TTACATCACA TAGGCACATT
GCTGTGAATC TATTAGAGCG AAACCATTTA GCATTTACCT GTGGCCTTGA ATTGGTTGGT GATTTTCTGT AAGCAGTAAT
TTGACTGACA TCCTAATTTG CAGGGGGGAA AAATTCTTTA TGGAGGATCT GCAATTGAAT CTGAGGGAAA CTTTGTTCAG
CCAACAATTG TGGAAATTTC ACCCTCTGCA CCGGTTGTGA GAGAAGAACT CTTTGGTCCT GTTCTTTATG TGATGAAAGT
TCAGGTATAA AAGATTCAAT TACTTTGCTT TTATGTTATT GATCTGTAAT GTTTGGTGTC AGTTGTATAG TGTTGGACCA
GATCATTATC ATTTACACTA CTTTTCGTGG TCATTACCTG CAGAATCTGA AGGAAGCAGT TGAAATCAAC AATTCTGTTC
CTCAAGGATT GAGCAGTTCT ATATTTACAA AGAGACCAGA TATTATTTTC AAGTGGATTG GGTAAGTGTC AGTTCAACCA
CCTAGAAAGT AGCCCCCTTG CAGCTAAGCT TGATTGTTAT AAATAGAAAT CAAGGCTCAC TTTGGCACTA ATGGATCTCC
ATCCTCCTGC TCATATGTAG CATTGTGTTT CCTGATGTCC TAAACTTGTT TTGGTGAAGG TATCAGACTT GTTTGCTTTT
ACTTTAATCT CATTGTTTCC CTGTTTATTG AATCACACTG AAATATTATT CAAGTTTAAC AGTTCAAATA TACTTAGGCT
TTTAGACCCT TTTTCCGTTA TGTGCATTAT ATGCATTATT AGTGTATTAA ATTCTTTTTT AAGATGATAT TTGATGTCCA
TATATATTGA CACCTAAAAA GAATCATAAA GCGATTTAAC ACTACTGAAT CCCCGCTATG TGTCATGACT AAATCATTGA
CCATATTCCT GTGTTGTGAA ATCCCCCATA TAATAAACCC TCTTCCGAGG ACAGCTGCAT GCCTACACCT TTCTTTTACA
CGCTCTCAGA TTTCTTTTAC TGCCATGCCC CATAAGACAT GAAATGACTA TGGTAGTGAT GTTCTTGCTC TTCTTGCTGT
ACAGGCCTCA TGGTAGTGAC TGTGGCATTG TTAATGTAAA TATTCCCACA AATGGTGCTG AAATTGGTGG AGCTTTTGGT
GGAGAAAAAG CTACTGGTGG TGGACGAGAA GCAGGGAGTG ATTCGTGGAA GCAGTACATG AGGAGGGCCA CTTGGTAAGT
AGACAAATTT TGATTCAAGT ATGCAAGCTA TACCTTGATC AATTGGTAAA ATTCCTAGTT CCTTTTGCAC TTTTCCCAAG
TTGTCGTTTG CAACAGCAGT AACTGAATAT TTACTGAAAT GTAAACTGTT CACTCCCATT GGTGAGTGGT GACCTTGGCT
TGGCATGATG GCTTCCTTAG AGACTCTAGT ACACTACAAT GATTAGCAAA gagtaaagtc catcaccggt ccttaaactt
gtaccgctgt atcatcccgg tccctaaact cgcaaatcga ccgttcaagt cctcaaactt gttcgactgt gtcatcctag
tctctaaact tgtagatcac tcgtttaggt cctccaactt attcagttgt gtcaccccgg tccctaaaca ggacggtcta
aaaactttat atcaaaaaat aattcataac tttttcatgt gaactctgaa gacaaacttt atatcaaaat tgtagctctc
gacgcgacct acaactttgt agttgaaaag tttttgaatt aaaactgttt agggtcccaa aatattgttg catgtttata
gattttgaaa ttttaatttt aaaattacat tttgggacaa aaaatgactt taaataaaaa aaattcaact acaaagttgt
agatcgcgtc gagggctaca agtttgatat aaagtttgtc ttcattagaa ttcatatgaa aaagttatga attattttta
aatataaagt ctttagacca tcctatttga cccagatgat attcaaatcc aagtttaggg accggggtga cacaaccgaa
caagttggag gacctaaatg agtgatctgc aagtttaggg accgggatga catagtcgaa caagtttgag gacctgaacg
gtcagtttgc gagtttaggg accgggatga cacaacggta caagtttagg gaccggtgat ggactttact cATTAGCAAA
CAAGGGGAAC AAATAATTGT TGATAAATTA CTGTAATGAA GTTATCATCT GTTGGAGTCT GTGTAAGCCT GTAAAATTGA
AGTCCCtaag gtggtgtttg gcaaggaggg actaaacttt agtccctctc acaaaaaatt tagtccctat gggagggact
tttgcttttg tgagagggac taaagtttag TTAGGGACTA ATTTTTTTGT GAGAGGGACT AAAGTTTAGT TAGGGACTAa
ggtggtgttt ggatccaggg acttaacttt agtctctata tttagacact aatttagagt attaaatata gactacttac
aaaattaatt atataaatga aagcaaattt gcgagacaaa atttttaagc ctaattaatc tataattaga gaatgtttac
tgtagcatca cataggctaa tcatagatta attaggctca atagattcgt ctcgcgaatt agtccaagat tatggatggg
ttttattaat agtctacgtt taatatttat aattagtgca aacattcgat gtgatagtga cttaaaagtt ttagtcccat
ctaaacaggg tctAATTTTT TTGTGAGAGG GACTAAAGTT TAGTCCCTCT TTCCCAAACA CCACCTAACT CTGTATCAAA
CTGCACGGAG AATAATTTAC ATAACCGGGA TCCAGCCACC ACAGTACCTT CTTTTTTCAC TGTGATTTTG AGTTTTGAAG
TTTCTGGCTA TTCTCTCATT GATGTTACGA TGTACATAAA ACTAATCTAC ATAAGGATGC TGTAACATTT CGGTTGTGTA
GACACCATTA CGCCATAGAA ATGTTGTCAG AATATCATCT CTGCCACCGC CCACCGGGCT ATTCCATGTC ATCCATTGTG
ATCATTCTGA CCTGGGATAG CACTTTTACC CAAAAGGCCT TGGGAGTACC ATCATACAAA TAGAAGCTTA GAATGCCATG
AAGCAATAAA TTCAAATAGA ACTACACATA TATATTACTC TATTATTAGC ACTGAGAAAA CCATTTGATT TGCTCTGCCA
TATTTTTCAA TGGGTATTTG CGACGTCCCA AAACTCTGTG AAGCATAGGG ATCACAATAT CTTATGTATA GATGTTCCCA
ATGAAAGGCT TATCCTATGT ACATTGAATT CTAGTTCCTT GAGATGTGAA CCATGCCATG AAGATAATTA CTGCAAGAGT
AGCTTCTGTT GCAAGATATT CAGGGCAATA ATTCTAGTGT GTGTTCACCA TGCTCGAAAT ACTTTGCATA GATAATTCTT
TATGTTATAG TTATGCATTT CCTGCACACT AATTCTCAAT CCAAATTTCT GCAGTACGAT CAACTATGGA AGCGAGCTGC
CTCTAGCACA AGGAATAAAT TTTGGCTAGT TCGGTGGTCA AGATCGGCTG ATGAACATGT TAAGCTTCAT CGACAGACTT
CAGGAATTTC TACTGGCGTC AACTGAAAAC CGAAACTTCA ACGCAGCAGC ATTGCTATGT GTGCATATAA TAAGAGATGA
GTCCAATATT AATGCATGTA CTGCTCTTGC TATGATTAGC CGTCGGAGTT CGAGTCCAAT AAACAGGGAA AAATTGCGTA
TTCCCTGATC GGTTGATATG TACCAACATT TCTGATGTAA TCTTTAGAAC GGTATCGGTT GAAAACTTGA AATGAACGAA
AACGCGGTAA GAATACAAAA TGGTGTGCAA ACCTTCAGGC T

Locus: Os09g0440300

Loading...

Locus: Os09g0440300

Loading...