Os09t0440300-03

Locus

Os09g0440300

Description

Similar to Aldehyde dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH7

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 7

Oryzabase Gene Symbol Synonym(s)

OsALDH7, osaldh7, LDH, ALDH7B7, OsALDH7B6, ALDH7B6

Oryzabase Gene Name Synonym(s)

Oryza sativa Aldehyde Dehydrogenase 7, Family 7 ALDH, lactic acid dehydrogenase, Aldehyde Dehydrogenase 7B6

Transcript Evidence

AK109168 (DDBJ, Best hit)

Protein Evidence

Q9FPK6 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-155-H03 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0440300-03)

RiceXPro (AK109168)

Others

Oryzabase (8278)

KEGG (Os09t0440300-03 (EC:1.2.1.3))

Transcript

556 bp

>Os09t0440300-03 Similar to Aldehyde dehydrogenase.
ACAGCCACCGCCTCCCCCACCCCACCCCGATCCCCTCCCCGCCGTACGGGCGCAGAAGGA
ACCCGTCTTCTAGAAGGAGGAGGAGGGCTACCTCTCTCTCTCTCTCTTCTGCCATGGGGA
GCTTCGCGAGGAAGGAGCACCAGTTCCTCGCCGAGCTTGGCCTCGCGCCGCGGAACCCCG
GGTCCTTCGCCTGCGGCGCCTGGGGCGGCTCGGGCCCCGTCGTCACGTCCACCAACCCGA
CGAACAACCAGGCGCGTCTCCCCCCACACGATCCGCTCGGTTCTAGGCGCTCGATTTGGT
TTGGGCCGCCCTGGCATTTTTGGGGTGTGTGTGATTGTGGTGGATTTTGATGGGGGATTT
TTTTTTGGGTGTTTTGTGGTTTAGGTCATCGCGGAGGTCGTGGAGGCGTCCGCGCGTGAG
TACGAGGAGGGCATGCGCGCCTGCTACGATGCCGCCAAGACCTGGATGGCGGTGAGTTTC
ACTTGACTTGCTGTGTTGGAGTGCTGATATCAATTCGTTCGGATGATGAAGTGCTCGTAC
TATGCTCTTGTGTGTC

CDS

237 bp

>Os09t0440300-03 Similar to Aldehyde dehydrogenase.
ATGGGGAGCTTCGCGAGGAAGGAGCACCAGTTCCTCGCCGAGCTTGGCCTCGCGCCGCGG
AACCCCGGGTCCTTCGCCTGCGGCGCCTGGGGCGGCTCGGGCCCCGTCGTCACGTCCACC
AACCCGACGAACAACCAGGCGCGTCTCCCCCCACACGATCCGCTCGGTTCTAGGCGCTCG
ATTTGGTTTGGGCCGCCCTGGCATTTTTGGGGTGTGTGTGATTGTGGTGGATTTTGA

Protein

79 aa

>Os09t0440300-03 Similar to Aldehyde dehydrogenase.
MGSFARKEHQFLAELGLAPRNPGSFACGAWGGSGPVVTSTNPTNNQARLPPHDPLGSRRS
IWFGPPWHFWGVCDCGGF*

5'UTR

chr09:16338352..16338464 (- strand) : 113 bp

CDS

chr09:16338115..16338351 (- strand) : 237 bp

3'UTR

chr09:16337909..16338114 (- strand) : 206 bp

FASTA

>Os09t0440300-03 class=Sequence position=chr09:16337909..16338464 (- strand)
ACAGCCACCG CCTCCCCCAC CCCACCCCGA TCCCCTCCCC GCCGTACGGG CGCAGAAGGA ACCCGTCTTC TAGAAGGAGG
AGGAGGGCTA CCTCTCTCTC TCTCTCTTCT GCCATGGGGA GCTTCGCGAG GAAGGAGCAC CAGTTCCTCG CCGAGCTTGG
CCTCGCGCCG CGGAACCCCG GGTCCTTCGC CTGCGGCGCC TGGGGCGGCT CGGGCCCCGT CGTCACGTCC ACCAACCCGA
CGAACAACCA GGCGCGTCTC CCCCCACACG ATCCGCTCGG TTCTAGGCGC TCGATTTGGT TTGGGCCGCC CTGGCATTTT
TGGGGTGTGT GTGATTGTGG TGGATTTTGA TGGGGGATTT TTTTTTGGGT GTTTTGTGGT TTAGGTCATC GCGGAGGTCG
TGGAGGCGTC CGCGCGTGAG TACGAGGAGG GCATGCGCGC CTGCTACGAT GCCGCCAAGA CCTGGATGGC GGTGAGTTTC
ACTTGACTTG CTGTGTTGGA GTGCTGATAT CAATTCGTTC GGATGATGAA GTGCTCGTAC TATGCTCTTG TGTGTC

Locus: Os09g0440300

Loading...

Locus: Os09g0440300

Loading...