Os09t0441900-01

Locus

Os09g0441900

Description

Unknown phosphatidylethanolamine-binding protein (PEBP) like domain protein, 426-amino-acid protein, homologous to the keratin-associated protein (KAP) 5-4 family, Panicle architecture, Panicle erectness

RAP-DB Gene Symbol Synonym(s)

DEP1, OsDEP1, EP, qPE9-1, DN1, DEP1/DN1/qPE9-1, qNGR9

RAP-DB Gene Name Synonym(s)

DENSE AND ERECT PANICLE 1, dense and erect panicle 1, erect-pose panicle, DENSE PANICLE 1, DENSE AND ERECT PANICLE1, DENSE AND ERECT PANICLES 1

CGSNL Gene Symbol

DEP1

CGSNL Gene Name

DENSE AND ERECT PANICLE 1

Oryzabase Gene Symbol Synonym(s)

OsDEP1, EP, qPE9-1, DN1, DEP1/DN1/qPE9-1, qNGR9, qDEP1, RGG4/DEP1/DN1/qPE9-1/OsGGC3, RGG4, OsDN1, OsGGC3, GGC3

Oryzabase Gene Name Synonym(s)

dense and erect panicle 1, erect-pose panicle, DENSE PANICLE 1, DENSE AND ERECT PANICLE1, DENSE AND ERECT PANICLES 1, G gamma subunit DEP1, Heterotrimeric G Protein gamma4 Subunit

Transcript Evidence

FJ039905 (Genbank)

AK101247 (Genbank)

Protein Evidence

Q67UU9 (UniProt)

Literature

PMID: 19305410

PMID: 19546322

Note

Manual Curation

October 19, 2009

Full-length cDNA

J033032C18 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0441900-01)

RiceXPro (AK101247)

Others

Oryzabase (8503)

KEGG (Os09t0441900-01)

Transcript

1833 bp

>Os09t0441900-01 Unknown phosphatidylethanolamine-binding protein (PEBP) like domain protein, 426-amino-acid protein, homologous to the keratin-associated protein (KAP) 5-4 family, Panicle architecture, Panicle erectness
TCTCTTCCCTCTCTCTCTTTCTCTCTCCAAACCCCACGCACGCCGCGTCGCCGCCTCCTC
CTCTCCATCTCCGCTGCTATTATTGCCCGCGCAGACGCAGGCCACCATCCTTCCTCTCGC
TCACGCTCGCTGCTATATGGGGGTCCTCCTCATCGCATCGCATCGCATCACCTCGCACGG
GCGCGCGCGCCGTGCCGTGCCGCTAGCTCGATCCGCCTCGTACGCCAGCTCGCTCGCTCG
CTCCCCCACCCCGCTGCTGCACGGCTGCGCCCGCGCTGTCCCCTGTCCCCCCGCTCGCCG
CGGCGATTTATACCCACCACGCCCCCTGCTGCTGCTATAATGCCCATGAGTGAAGGCGGC
GAGGGGTGGTTCTGAGTTGGCCGTTGGCGTGCTGCGTGTGGAGATGGGGGAGGAGGCGGT
GGTGATGGAGGCGCCGAGGCCCAAGTCGCCGCCGAGGTACCCGGACCTGTGCGGCCGGCG
GCGGATGCAGCTGGAGGTGCAGATCCTGAGCCGCGAGATCACGTTCCTCAAGGATGAGCT
TCACTTCCTTGAAGGAGCTCAGCCCGTTTCTCGTTCTGGATGCATTAAAGAGATAAATGA
GTTTGTTGGTACAAAACATGACCCACTAATACCAACAAAGAGAAGGAGGCACAGATCTTG
CCGTCTTTTTCGGTGGATCGGATCAAAATTGTGTATCTGCATTTCATGTCTTTGCTACTG
TTGCAAGTGCTCACCCAAGTGCAAAAGACCAAGGTGCCTCAATTGTTCTTGCAGCTCATG
CTGCGACGAGCCATGCTGTAAGCCAAACTGCAGTGCGTGCTGCGCTGGGTCATGCTGTAG
TCCAGACTGCTGCTCATGCTGTAAACCTAACTGCAGTTGCTGCAAGACCCCTTCTTGCTG
CAAACCGAACTGCTCGTGCTCCTGTCCAAGCTGCAGCTCATGCTGCGATACATCGTGCTG
CAAACCGAGCTGCACCTGCTTCAACATCTTTTCATGCTTCAAATCCCTGTACAGCTGCTT
CAAGATCCCTTCATGCTTCAAGTCCCAGTGCAACTGCTCTAGCCCCAATTGCTGCACTTG
CACCCTTCCAAGCTGTAGCTGCAAGGGCTGTGCCTGTCCAAGCTGTGGATGCAACGGCTG
TGGCTGTCCAAGCTGCGGATGCAACGGTTGTGGCTGTCCAAGCTGCGGTTGCAACGGCTG
TGGCCTTCCAAGCTGCGGTTGCAACGGCTGCGGCTCGTGCTCTTGCGCCCAATGCAAACC
CGATTGTGGCTCGTGCTCTACCAATTGCTGTAGCTGCAAGCCAAGCTGCAACGGCTGCTG
CGGCGAGCAGTGCTGCCGCTGCGCGGACTGCTTCTCCTGCTCGTGCCCTCGTTGCTCCAG
CTGCTTCAACATCTTCAAATGCTCCTGCGCTGGCTGCTGCTCGAGCCTGTGCAAGTGCCC
CTGCACGACGCAGTGCTTCAGCTGCCAGTCGTCATGCTGCAAGCGGCAGCCTTCGTGCTG
CAAGTGCCAGTCGTCTTGCTGCGAGGGGCAGCCTTCCTGCTGCGAGGGACACTGCTGCAG
CCTCCCGAAACCGTCGTGCCCTGAATGTTCCTGTGGGTGTGTCTGGTCTTGCAAGAATTG
TACAGAGGGTTGTCGATGCCCACGGTGTCGTAACCCATGCTGTCTCAGTGGTTGCTTATG
TTGATCTAGATCCTTTTTTGGTTGTTGTTTTTCTTGTATTTTTTAGTTGTTAGGCCTTTG
ATTAAGTTCGAACTTTCATAAATATATGGTGTTTATCCTGTAAAGAAATGATGATTTCAA
GGATTTTTCATAGCTATGAGACGAGGTTGAACC

CDS

1281 bp

>Os09t0441900-01 Unknown phosphatidylethanolamine-binding protein (PEBP) like domain protein, 426-amino-acid protein, homologous to the keratin-associated protein (KAP) 5-4 family, Panicle architecture, Panicle erectness
ATGGGGGAGGAGGCGGTGGTGATGGAGGCGCCGAGGCCCAAGTCGCCGCCGAGGTACCCG
GACCTGTGCGGCCGGCGGCGGATGCAGCTGGAGGTGCAGATCCTGAGCCGCGAGATCACG
TTCCTCAAGGATGAGCTTCACTTCCTTGAAGGAGCTCAGCCCGTTTCTCGTTCTGGATGC
ATTAAAGAGATAAATGAGTTTGTTGGTACAAAACATGACCCACTAATACCAACAAAGAGA
AGGAGGCACAGATCTTGCCGTCTTTTTCGGTGGATCGGATCAAAATTGTGTATCTGCATT
TCATGTCTTTGCTACTGTTGCAAGTGCTCACCCAAGTGCAAAAGACCAAGGTGCCTCAAT
TGTTCTTGCAGCTCATGCTGCGACGAGCCATGCTGTAAGCCAAACTGCAGTGCGTGCTGC
GCTGGGTCATGCTGTAGTCCAGACTGCTGCTCATGCTGTAAACCTAACTGCAGTTGCTGC
AAGACCCCTTCTTGCTGCAAACCGAACTGCTCGTGCTCCTGTCCAAGCTGCAGCTCATGC
TGCGATACATCGTGCTGCAAACCGAGCTGCACCTGCTTCAACATCTTTTCATGCTTCAAA
TCCCTGTACAGCTGCTTCAAGATCCCTTCATGCTTCAAGTCCCAGTGCAACTGCTCTAGC
CCCAATTGCTGCACTTGCACCCTTCCAAGCTGTAGCTGCAAGGGCTGTGCCTGTCCAAGC
TGTGGATGCAACGGCTGTGGCTGTCCAAGCTGCGGATGCAACGGTTGTGGCTGTCCAAGC
TGCGGTTGCAACGGCTGTGGCCTTCCAAGCTGCGGTTGCAACGGCTGCGGCTCGTGCTCT
TGCGCCCAATGCAAACCCGATTGTGGCTCGTGCTCTACCAATTGCTGTAGCTGCAAGCCA
AGCTGCAACGGCTGCTGCGGCGAGCAGTGCTGCCGCTGCGCGGACTGCTTCTCCTGCTCG
TGCCCTCGTTGCTCCAGCTGCTTCAACATCTTCAAATGCTCCTGCGCTGGCTGCTGCTCG
AGCCTGTGCAAGTGCCCCTGCACGACGCAGTGCTTCAGCTGCCAGTCGTCATGCTGCAAG
CGGCAGCCTTCGTGCTGCAAGTGCCAGTCGTCTTGCTGCGAGGGGCAGCCTTCCTGCTGC
GAGGGACACTGCTGCAGCCTCCCGAAACCGTCGTGCCCTGAATGTTCCTGTGGGTGTGTC
TGGTCTTGCAAGAATTGTACAGAGGGTTGTCGATGCCCACGGTGTCGTAACCCATGCTGT
CTCAGTGGTTGCTTATGTTGA

Protein

427 aa

>Os09t0441900-01 Unknown phosphatidylethanolamine-binding protein (PEBP) like domain protein, 426-amino-acid protein, homologous to the keratin-associated protein (KAP) 5-4 family, Panicle architecture, Panicle erectness
MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKDELHFLEGAQPVSRSGC
IKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISCLCYCCKCSPKCKRPRCLN
CSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCCKTPSCCKPNCSCSCPSCSSC
CDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNCSSPNCCTCTLPSCSCKGCACPS
CGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGCGSCSCAQCKPDCGSCSTNCCSCKP
SCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCSCAGCCSSLCKCPCTTQCFSCQSSCCK
RQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSCPECSCGCVWSCKNCTEGCRCPRCRNPCC
LSGCLC*

5'UTR

chr09:16411151..16411553 (+ strand) : 403 bp

CDS

chr09:16411554..16411682 (+ strand) : 129 bp

chr09:16412895..16412953 (+ strand) : 59 bp

chr09:16414109..16414153 (+ strand) : 45 bp

chr09:16414240..16414284 (+ strand) : 45 bp

chr09:16414700..16415702 (+ strand) : 1003 bp

3'UTR

chr09:16415703..16415851 (+ strand) : 149 bp

FASTA

>Os09t0441900-01 class=Sequence position=chr09:16411151..16415851 (+ strand)
TCTCTTCCCT CTCTCTCTTT CTCTCTCCAA ACCCCACGCA CGCCGCGTCG CCGCCTCCTC CTCTCCATCT CCGCTGCTAT
TATTGCCCGC GCAGACGCAG GCCACCATCC TTCCTCTCGC TCACGCTCGC TGCTATATGG GGGTCCTCCT CATCGCATCG
CATCGCATCA CCTCGCACGG GCGCGCGCGC CGTGCCGTGC CGCTAGCTCG ATCCGCCTCG TACGCCAGCT CGCTCGCTCG
CTCCCCCACC CCGCTGCTGC ACGGCTGCGC CCGCGCTGTC CCCTGTCCCC CCGCTCGCCG CGGCGATTTA TACCCACCAC
GCCCCCTGCT GCTGCTATAA TGCCCATGAG TGAAGGCGGC GAGGGGTGGT TCTGAGTTGG CCGTTGGCGT GCTGCGTGTG
GAGATGGGGG AGGAGGCGGT GGTGATGGAG GCGCCGAGGC CCAAGTCGCC GCCGAGGTAC CCGGACCTGT GCGGCCGGCG
GCGGATGCAG CTGGAGGTGC AGATCCTGAG CCGCGAGATC ACGTTCCTCA AGGTGAGCGC CCCGCGGCGG CGGCGGCTGC
GTTTTTCTCT ATAGGTTTCT CTTTCACACT CGCTCGCTCG AAATTCTCGG GGCCCGAGCT CTACTTGCTT CGTCTTCCTT
TGACTTTACC GATTAATTTT AAAAAAAAGG AGATCCGATT CGCCGCGCAT TTTTCAAAAC CCAAGCGGCC GAGTACGGAG
CTACCCGCTA CTGCAAGTAG GATGCTGTGA AGTGTACAGT AATGGCGTTG TTAATTGCGG TAGCTAGTGC TATTCTAGTA
CTTGTAGTAC TGTTTCTAGG CGGAGGTGAA TCACGGCGCC ATCAATCCGA GGCTGGCGAG ACAAGCTTGG CCCTCTTTGG
GCGTGGCGCC ATGGCTGTAC TACCTTTGTC GTTGTTTGGT TGGGCTCCTC GTTGGAGAAA AGAAGAGCGT GGGCATGGAC
AACTGACCTG AGTGGCCTTG TCAGGGAGAG CCATAGCAGT GGACGTGTCT ATCTCCGCCA TTGCTTCGTC GACACTGGAC
GTGCAGACGG CATGGCCATG AGGGCTTTGC ACGATGGGTG GTGCCGTGTT GGTGTTATGG GCTGCCACCA TGGTTTGAGG
CTTTTGATGT TGCTAGATTT TGTGTTTAAC GAGGGAGGGA AGAATGTGTT GTTCTTGACA CTGTGCTGTG CTTTTAAGGA
GCAGAGATTT CAGAAGCTCT TCAGATATCA GAGAACTTCT TTGTAGTAGT AATCAAATGC GCTTTAGACA TCTTTTTATC
GTTTCTTGCA AGGTCAGTCC CTGCTTTGGT ACCCGATCTC GCTTTTGTGC AACATCAAAG TTACACTTAC ACAGTAAAGC
AGGAATCTTT ATGGGACCGT TCGTACTGGT CAATTACTCC AGGCTTTGAT TAATGGGTTT TAAGTTTTAA CCGCAGATTT
GGTACAAGTA ACAACCTTTA TTTACTTTTT ATTTCTGCAA CTGTGTCTTT TAACATGAAA GAATCCAGCT CCATTCAAAA
GTTTAGTTTT TATTTTCCAT TGTGGTGCAT GGTCACTCAG CCTGCAGTAC TGAATTATCA AAATTTTCTT TTGTCATTTC
TCTCATGTTA AGTGCATAGT CTATTTTACT TCAACAGGTA GAAAAACTTT TGTGGGTTTG TTTCTAGCTC AAGGAGGAAA
TTCATGGGTT TGCATCTAGC ACATGAGAGA ACAATATTGG TCTAACACAA AGCTCCTTTT GTAGGATGAG CTTCACTTCC
TTGAAGGAGC TCAGCCCGTT TCTCGTTCTG GATGCATTAA AGAGTATGTA CTACTGCCCT TCATGCATTA CAGATATTTT
GTTTTTAAGT TTTTAGAAAT TTGAAGAGCT TATGTCAAGT ATGAAATGTC AGCTTAATTT TATTGCTGTC CTTATCTAAT
GTCTTATGCT CTGTTTTATA AAATTTGGTT GCATTTTCTC CCCCAGGGAA AAATCTTGTA TAAGTGTGTT ATGTACTTAT
GTGTATAAAA TCTTGTTGCA CTTGTATGTC ACACTTAggc cctgtttaga tcctccaaaa tggcagtttg ccattttgaa
gaaccttttg ccattttgga tctaaacact agtaacaaaa cttggcaatt tggcatttgg catttgctag tctatagtag
caaattgtgc caaaaagtgc tttggaacca ctctctcttt ctttctctct ctcactttag tgctagaatg gtaaaagttt
aggatgcatc taaacaccaa ctagtacttt tacaatacta aaacttttgc caccaaaact tttgccattt gccatttgct
atttcaaatg gatctaaaca gggccTTAGC AAATCACCAT ATGTTAAAAT TACCTTGGGA TGAAAAAGAA AAAGGAAACC
AGCATTGAAG TCTTGTTTGA AATGCATATG TACTTGTACC ATTACAGAAA TTCTTAAAAC TGCTGTCTTG ACAGCTACTT
ATCAAACAGC CCCACCTGCA TCATAACGTT CCTAGTGGTG CCTATAACTC TGCCTCAGTT ATTATTTTGT GGCCCACTGG
TCCAACAATT TGAAAAAAAT TATATTGAAC TAAATATATT GAACAGTAGT ATGACGTCCT CTTTGCTTGA GTTCCATATT
ACAGCTCACA GTCCTGAGAT TTGTTTCACC GATTCTTTCC ATGCGATGTG CACATATTCT TATTCAATTT AAAAAATGAA
AGCAGATTAT TTTTAACAAG TAACCTATCA CGTTAGCTTA ACATTGTATA TTTGTGGTGG AATTATGTAA TATTCCGATA
TCGCATTTGA AGTTTTGAAC ATGTGTGCTC AAATTGAGGG ACACATGACT GTAGTGAAAG CAAATATAAA TGTCTGAGCA
ATGGACTATA CTTTGTATTC ATTACTACAA GTTATGTCCT TTTGCAGGTT GCTAATGTCC TCTTACATTA CTTGTCAGGA
TAAATGAGTT TGTTGGTACA AAACATGACC CACTAATACC AACGTATGGC CTCTAAACTT TCAGTTCCCC CATTTTAAGC
ATGTTCGCTG TTTATTTACG AGTTTTGACA TTGTTTTTTC CTTTTCCAGA AAGAGAAGGA GGCACAGATC TTGCCGTCTT
TTTCGGTGGA TCGGGTATGT TTTGATCCAA TATAGTTTGC TCGCAGGTTC TGAGGGGCAA GAACATTCAA ATATCTATAA
TGTTTTCTGT TGGATTCAAC ATTCATCACT ATTTCCCTCG AAAAAAAAGC ATTCGTCACT ATTGGAATTG AAAGTCTGAA
AGTGCCTCTA GTCCCTTTGT ATGTTAAAAG TCAATAAACA AGCAGTAGTT TTCTATATGC CACATTAATA TTATTGACGC
ATTTTAAAAA GCAAACTAGT CCAGGGATGT AATCATCTTT GTTATCTAAA ACTAAAAAAG GAAAAACTAG TGCTTTTTTA
CATTAACATT GATTTTTTTG CGGCTGAAAT TACATGTAGA AACTTTGGCA TAATAATCTG TACTACTGCC AAACTGAGCT
TTTACATGGT GAAAATATTT TCCCTGCAGA TCAAAATTGT GTATCTGCAT TTCATGTCTT TGCTACTGTT GCAAGTGCTC
ACCCAAGTGC AAAAGACCAA GGTGCCTCAA TTGTTCTTGC AGCTCATGCT GCGACGAGCC ATGCTGTAAG CCAAACTGCA
GTGCGTGCTG CGCTGGGTCA TGCTGTAGTC CAGACTGCTG CTCATGCTGT AAACCTAACT GCAGTTGCTG CAAGACCCCT
TCTTGCTGCA AACCGAACTG CTCGTGCTCC TGTCCAAGCT GCAGCTCATG CTGCGATACA TCGTGCTGCA AACCGAGCTG
CACCTGCTTC AACATCTTTT CATGCTTCAA ATCCCTGTAC AGCTGCTTCA AGATCCCTTC ATGCTTCAAG TCCCAGTGCA
ACTGCTCTAG CCCCAATTGC TGCACTTGCA CCCTTCCAAG CTGTAGCTGC AAGGGCTGTG CCTGTCCAAG CTGTGGATGC
AACGGCTGTG GCTGTCCAAG CTGCGGATGC AACGGTTGTG GCTGTCCAAG CTGCGGTTGC AACGGCTGTG GCCTTCCAAG
CTGCGGTTGC AACGGCTGCG GCTCGTGCTC TTGCGCCCAA TGCAAACCCG ATTGTGGCTC GTGCTCTACC AATTGCTGTA
GCTGCAAGCC AAGCTGCAAC GGCTGCTGCG GCGAGCAGTG CTGCCGCTGC GCGGACTGCT TCTCCTGCTC GTGCCCTCGT
TGCTCCAGCT GCTTCAACAT CTTCAAATGC TCCTGCGCTG GCTGCTGCTC GAGCCTGTGC AAGTGCCCCT GCACGACGCA
GTGCTTCAGC TGCCAGTCGT CATGCTGCAA GCGGCAGCCT TCGTGCTGCA AGTGCCAGTC GTCTTGCTGC GAGGGGCAGC
CTTCCTGCTG CGAGGGACAC TGCTGCAGCC TCCCGAAACC GTCGTGCCCT GAATGTTCCT GTGGGTGTGT CTGGTCTTGC
AAGAATTGTA CAGAGGGTTG TCGATGCCCA CGGTGTCGTA ACCCATGCTG TCTCAGTGGT TGCTTATGTT GATCTAGATC
CTTTTTTGGT TGTTGTTTTT CTTGTATTTT TTAGTTGTTA GGCCTTTGAT TAAGTTCGAA CTTTCATAAA TATATGGTGT
TTATCCTGTA AAGAAATGAT GATTTCAAGG ATTTTTCATA GCTATGAGAC GAGGTTGAAC C