Os09t0441900-02

Locus

Os09g0441900

Description

Similar to Keratin associated protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DEP1

CGSNL Gene Name

DENSE AND ERECT PANICLE 1

Oryzabase Gene Symbol Synonym(s)

OsDEP1, EP, qPE9-1, DN1, DEP1/DN1/qPE9-1, qNGR9, qDEP1, RGG4/DEP1/DN1/qPE9-1/OsGGC3, RGG4, OsDN1, OsGGC3, GGC3

Oryzabase Gene Name Synonym(s)

dense and erect panicle 1, erect-pose panicle, DENSE PANICLE 1, DENSE AND ERECT PANICLE1, DENSE AND ERECT PANICLES 1, G gamma subunit DEP1, Heterotrimeric G Protein gamma4 Subunit

Transcript Evidence

AK064043 (DDBJ, Best hit)

Protein Evidence

B8Y995 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-125-D04 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0441900-02)

RiceXPro (AK064043)

Others

Oryzabase (8503)

KEGG (Os09t0441900-02)

Transcript

1526 bp

>Os09t0441900-02 Similar to Keratin associated protein.
AATGCCCATGAGTGAAGGCGGCGAGGGGTGGTTCTGAGTTGGCCGTTGGCGTGCTGCGTG
TGGAGATGGGGGAGGAGGCGGTGGTGATGGAGGCGCCGAGGCCCAAGTCGCCGCCGAGGT
ACCCGGACCTGTGCGGCCGGCGGCGGATGCAGCTGGAGGTGCAGATCCTGAGCCGCGAGA
TCACGTTCCTCAAGGATGAGCTTCACTTCCTTGAAGGAGCTCAGCCCGTTTCTCGTTCTG
GATGCATTAAAGAGTTGCTAATGTCCTCTTACATTACTTGTCAGGATAAATGAGTTTGTT
GGTACAAAACATGACCCACTAATACCAACAAAGAGAAGGAGGCACAGATCTTGCCGTCTT
TTTCGGTGGATCGGATCAAAATTGTGTATCTGCATTTCATGTCTTTGCTACTGTTGCAAG
TGCTCACCCAAGTGCAAAAGACCAAGGTGCCTCAATTGTTCTTGCAGCTCATGCTGCGAC
GAGCCATGCTGTAAGCCAAACTGCAGTGCGTGCTGCGCTGGGTCATGCTGTAGTCCAGAC
TGCTGCTCATGCTGTAAACCTAACTGCAGTTGCTGCAAGACCCCTTCTTGCTGCAAACCG
AACTGCTCGTGCTCCTGTCCAAGCTGCAGCTCATGCTGCGATACATCGTGCTGCAAACCG
AGCTGCACCTGCTTCAACATCTTTTCATGCTTCAAATCCCTGTACAGCTGCTTCAAGATC
CCTTCATGCTTCAAGTCCCAGTGCAACTGCTCTAGCCCCAATTGCTGCACTTGCACCCTT
CCAAGCTGTAGCTGCAAGGGCTGTGCCTGTCCAAGCTGTGGATGCAACGGCTGTGGCTGT
CCAAGCTGCGGATGCAACGGTTGTGGCTGTCCAAGCTGCGGTTGCAACGGCTGTGGCCTT
CCAAGCTGCGGTTGCAACGGCTGCGGCTCGTGCTCTTGCGCCCAATGCAAACCCGATTGT
GGCTCGTGCTCTACCAATTGCTGTAGCTGCAAGCCAAGCTGCAACGGCTGCTGCGGCGAG
CAGTGCTGCCGCTGCGCGGACTGCTTCTCCTGCTCGTGCCCTCGTTGCTCCAGCTGCTTC
AACATCTTCAAATGCTCCTGCGCTGGCTGCTGCTCGAGCCTGTGCAAGTGCCCCTGCACG
ACGCAGTGCTTCAGCTGCCAGTCGTCATGCTGCAAGCGGCAGCCTTCGTGCTGCAAGTGC
CAGTCGTCTTGCTGCGAGGGGCAGCCTTCCTGCTGCGAGGGACACTGCTGCAGCCTCCCG
AAACCGTCGTGCCCTGAATGTTCCTGTGGGTGTGTCTGGTCTTGCAAGAATTGTACAGAG
GGTTGTCGATGCCCACGGTGTCGTAACCCATGCTGTCTCAGTGGTTGCTTATGTTGATCT
AGATCCTTTTTTGGTTGTTGTTTTTCTTGTATTTTTTAGTTGTTAGGCCTTTGATTAAGT
TCGAACTTTCATAAATATATGGTGTTTATCCTGTAAAGAAATGATGATTTCAAGGATTTT
TCATAGCTATGAGACGAGGTTGAACC

CDS

228 bp

>Os09t0441900-02 Similar to Keratin associated protein.
ATGGGGGAGGAGGCGGTGGTGATGGAGGCGCCGAGGCCCAAGTCGCCGCCGAGGTACCCG
GACCTGTGCGGCCGGCGGCGGATGCAGCTGGAGGTGCAGATCCTGAGCCGCGAGATCACG
TTCCTCAAGGATGAGCTTCACTTCCTTGAAGGAGCTCAGCCCGTTTCTCGTTCTGGATGC
ATTAAAGAGTTGCTAATGTCCTCTTACATTACTTGTCAGGATAAATGA

Protein

76 aa

>Os09t0441900-02 Similar to Keratin associated protein.
MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKDELHFLEGAQPVSRSGC
IKELLMSSYITCQDK*

5'UTR

chr09:16411489..16411553 (+ strand) : 65 bp

CDS

chr09:16411554..16411682 (+ strand) : 129 bp

chr09:16412895..16412953 (+ strand) : 59 bp

chr09:16414078..16414117 (+ strand) : 40 bp

3'UTR

chr09:16414118..16414153 (+ strand) : 36 bp

chr09:16414240..16414284 (+ strand) : 45 bp

chr09:16414700..16415851 (+ strand) : 1152 bp

FASTA

>Os09t0441900-02 class=Sequence position=chr09:16411489..16415851 (+ strand)
AATGCCCATG AGTGAAGGCG GCGAGGGGTG GTTCTGAGTT GGCCGTTGGC GTGCTGCGTG TGGAGATGGG GGAGGAGGCG
GTGGTGATGG AGGCGCCGAG GCCCAAGTCG CCGCCGAGGT ACCCGGACCT GTGCGGCCGG CGGCGGATGC AGCTGGAGGT
GCAGATCCTG AGCCGCGAGA TCACGTTCCT CAAGGTGAGC GCCCCGCGGC GGCGGCGGCT GCGTTTTTCT CTATAGGTTT
CTCTTTCACA CTCGCTCGCT CGAAATTCTC GGGGCCCGAG CTCTACTTGC TTCGTCTTCC TTTGACTTTA CCGATTAATT
TTAAAAAAAA GGAGATCCGA TTCGCCGCGC ATTTTTCAAA ACCCAAGCGG CCGAGTACGG AGCTACCCGC TACTGCAAGT
AGGATGCTGT GAAGTGTACA GTAATGGCGT TGTTAATTGC GGTAGCTAGT GCTATTCTAG TACTTGTAGT ACTGTTTCTA
GGCGGAGGTG AATCACGGCG CCATCAATCC GAGGCTGGCG AGACAAGCTT GGCCCTCTTT GGGCGTGGCG CCATGGCTGT
ACTACCTTTG TCGTTGTTTG GTTGGGCTCC TCGTTGGAGA AAAGAAGAGC GTGGGCATGG ACAACTGACC TGAGTGGCCT
TGTCAGGGAG AGCCATAGCA GTGGACGTGT CTATCTCCGC CATTGCTTCG TCGACACTGG ACGTGCAGAC GGCATGGCCA
TGAGGGCTTT GCACGATGGG TGGTGCCGTG TTGGTGTTAT GGGCTGCCAC CATGGTTTGA GGCTTTTGAT GTTGCTAGAT
TTTGTGTTTA ACGAGGGAGG GAAGAATGTG TTGTTCTTGA CACTGTGCTG TGCTTTTAAG GAGCAGAGAT TTCAGAAGCT
CTTCAGATAT CAGAGAACTT CTTTGTAGTA GTAATCAAAT GCGCTTTAGA CATCTTTTTA TCGTTTCTTG CAAGGTCAGT
CCCTGCTTTG GTACCCGATC TCGCTTTTGT GCAACATCAA AGTTACACTT ACACAGTAAA GCAGGAATCT TTATGGGACC
GTTCGTACTG GTCAATTACT CCAGGCTTTG ATTAATGGGT TTTAAGTTTT AACCGCAGAT TTGGTACAAG TAACAACCTT
TATTTACTTT TTATTTCTGC AACTGTGTCT TTTAACATGA AAGAATCCAG CTCCATTCAA AAGTTTAGTT TTTATTTTCC
ATTGTGGTGC ATGGTCACTC AGCCTGCAGT ACTGAATTAT CAAAATTTTC TTTTGTCATT TCTCTCATGT TAAGTGCATA
GTCTATTTTA CTTCAACAGG TAGAAAAACT TTTGTGGGTT TGTTTCTAGC TCAAGGAGGA AATTCATGGG TTTGCATCTA
GCACATGAGA GAACAATATT GGTCTAACAC AAAGCTCCTT TTGTAGGATG AGCTTCACTT CCTTGAAGGA GCTCAGCCCG
TTTCTCGTTC TGGATGCATT AAAGAGTATG TACTACTGCC CTTCATGCAT TACAGATATT TTGTTTTTAA GTTTTTAGAA
ATTTGAAGAG CTTATGTCAA GTATGAAATG TCAGCTTAAT TTTATTGCTG TCCTTATCTA ATGTCTTATG CTCTGTTTTA
TAAAATTTGG TTGCATTTTC TCCCCCAGGG AAAAATCTTG TATAAGTGTG TTATGTACTT ATGTGTATAA AATCTTGTTG
CACTTGTATG TCACACTTAg gccctgttta gatcctccaa aatggcagtt tgccattttg aagaaccttt tgccattttg
gatctaaaca ctagtaacaa aacttggcaa tttggcattt ggcatttgct agtctatagt agcaaattgt gccaaaaagt
gctttggaac cactctctct ttctttctct ctctcacttt agtgctagaa tggtaaaagt ttaggatgca tctaaacacc
aactagtact tttacaatac taaaactttt gccaccaaaa cttttgccat ttgccatttg ctatttcaaa tggatctaaa
cagggccTTA GCAAATCACC ATATGTTAAA ATTACCTTGG GATGAAAAAG AAAAAGGAAA CCAGCATTGA AGTCTTGTTT
GAAATGCATA TGTACTTGTA CCATTACAGA AATTCTTAAA ACTGCTGTCT TGACAGCTAC TTATCAAACA GCCCCACCTG
CATCATAACG TTCCTAGTGG TGCCTATAAC TCTGCCTCAG TTATTATTTT GTGGCCCACT GGTCCAACAA TTTGAAAAAA
ATTATATTGA ACTAAATATA TTGAACAGTA GTATGACGTC CTCTTTGCTT GAGTTCCATA TTACAGCTCA CAGTCCTGAG
ATTTGTTTCA CCGATTCTTT CCATGCGATG TGCACATATT CTTATTCAAT TTAAAAAATG AAAGCAGATT ATTTTTAACA
AGTAACCTAT CACGTTAGCT TAACATTGTA TATTTGTGGT GGAATTATGT AATATTCCGA TATCGCATTT GAAGTTTTGA
ACATGTGTGC TCAAATTGAG GGACACATGA CTGTAGTGAA AGCAAATATA AATGTCTGAG CAATGGACTA TACTTTGTAT
TCATTACTAC AAGTTATGTC CTTTTGCAGG TTGCTAATGT CCTCTTACAT TACTTGTCAG GATAAATGAG TTTGTTGGTA
CAAAACATGA CCCACTAATA CCAACGTATG GCCTCTAAAC TTTCAGTTCC CCCATTTTAA GCATGTTCGC TGTTTATTTA
CGAGTTTTGA CATTGTTTTT TCCTTTTCCA GAAAGAGAAG GAGGCACAGA TCTTGCCGTC TTTTTCGGTG GATCGGGTAT
GTTTTGATCC AATATAGTTT GCTCGCAGGT TCTGAGGGGC AAGAACATTC AAATATCTAT AATGTTTTCT GTTGGATTCA
ACATTCATCA CTATTTCCCT CGAAAAAAAA GCATTCGTCA CTATTGGAAT TGAAAGTCTG AAAGTGCCTC TAGTCCCTTT
GTATGTTAAA AGTCAATAAA CAAGCAGTAG TTTTCTATAT GCCACATTAA TATTATTGAC GCATTTTAAA AAGCAAACTA
GTCCAGGGAT GTAATCATCT TTGTTATCTA AAACTAAAAA AGGAAAAACT AGTGCTTTTT TACATTAACA TTGATTTTTT
TGCGGCTGAA ATTACATGTA GAAACTTTGG CATAATAATC TGTACTACTG CCAAACTGAG CTTTTACATG GTGAAAATAT
TTTCCCTGCA GATCAAAATT GTGTATCTGC ATTTCATGTC TTTGCTACTG TTGCAAGTGC TCACCCAAGT GCAAAAGACC
AAGGTGCCTC AATTGTTCTT GCAGCTCATG CTGCGACGAG CCATGCTGTA AGCCAAACTG CAGTGCGTGC TGCGCTGGGT
CATGCTGTAG TCCAGACTGC TGCTCATGCT GTAAACCTAA CTGCAGTTGC TGCAAGACCC CTTCTTGCTG CAAACCGAAC
TGCTCGTGCT CCTGTCCAAG CTGCAGCTCA TGCTGCGATA CATCGTGCTG CAAACCGAGC TGCACCTGCT TCAACATCTT
TTCATGCTTC AAATCCCTGT ACAGCTGCTT CAAGATCCCT TCATGCTTCA AGTCCCAGTG CAACTGCTCT AGCCCCAATT
GCTGCACTTG CACCCTTCCA AGCTGTAGCT GCAAGGGCTG TGCCTGTCCA AGCTGTGGAT GCAACGGCTG TGGCTGTCCA
AGCTGCGGAT GCAACGGTTG TGGCTGTCCA AGCTGCGGTT GCAACGGCTG TGGCCTTCCA AGCTGCGGTT GCAACGGCTG
CGGCTCGTGC TCTTGCGCCC AATGCAAACC CGATTGTGGC TCGTGCTCTA CCAATTGCTG TAGCTGCAAG CCAAGCTGCA
ACGGCTGCTG CGGCGAGCAG TGCTGCCGCT GCGCGGACTG CTTCTCCTGC TCGTGCCCTC GTTGCTCCAG CTGCTTCAAC
ATCTTCAAAT GCTCCTGCGC TGGCTGCTGC TCGAGCCTGT GCAAGTGCCC CTGCACGACG CAGTGCTTCA GCTGCCAGTC
GTCATGCTGC AAGCGGCAGC CTTCGTGCTG CAAGTGCCAG TCGTCTTGCT GCGAGGGGCA GCCTTCCTGC TGCGAGGGAC
ACTGCTGCAG CCTCCCGAAA CCGTCGTGCC CTGAATGTTC CTGTGGGTGT GTCTGGTCTT GCAAGAATTG TACAGAGGGT
TGTCGATGCC CACGGTGTCG TAACCCATGC TGTCTCAGTG GTTGCTTATG TTGATCTAGA TCCTTTTTTG GTTGTTGTTT
TTCTTGTATT TTTTAGTTGT TAGGCCTTTG ATTAAGTTCG AACTTTCATA AATATATGGT GTTTATCCTG TAAAGAAATG
ATGATTTCAA GGATTTTTCA TAGCTATGAG ACGAGGTTGA ACC