Os09t0441900-03

Locus

Os09g0441900

Description

Similar to Keratin associated protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DEP1

CGSNL Gene Name

DENSE AND ERECT PANICLE 1

Oryzabase Gene Symbol Synonym(s)

OsDEP1, EP, qPE9-1, DN1, DEP1/DN1/qPE9-1, qNGR9, qDEP1, RGG4/DEP1/DN1/qPE9-1/OsGGC3, RGG4, OsDN1, OsGGC3, GGC3

Oryzabase Gene Name Synonym(s)

dense and erect panicle 1, erect-pose panicle, DENSE PANICLE 1, DENSE AND ERECT PANICLE1, DENSE AND ERECT PANICLES 1, G gamma subunit DEP1, Heterotrimeric G Protein gamma4 Subunit

Transcript Evidence

AK102904 (DDBJ, Best hit)

Protein Evidence

B8Y995 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J033113E20 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0441900-03)

RiceXPro (AK102904)

Others

Oryzabase (8503)

KEGG (Os09t0441900-03)

Transcript

2112 bp

>Os09t0441900-03 Similar to Keratin associated protein.
GGAGAAAAGAAGAGCGTGGGCATGGACAACTGACCTGAGTGGCCTTGTCAGGGAGAGCCA
TAGCAGTGGACGTGTCTATCTCCGCCATTGCTTCGTCGACACTGGACGTGCAGACGGCAT
GGCCATGAGGGCTTTGCACGATGGGTGGTGCCGTGTTGGTGTTATGGGCTGCCACCATGG
TTTGAGGCTTTTGATGTTGCTAGATTTTGTGTTTAACGAGGGAGGGAAGAATGTGTTGTT
CTTGACACTGTGCTGTGCTTTTAAGGAGCAGAGATTTCAGAAGCTCTTCAGATATCAGAG
AACTTCTTTGTAGTAGTAATCAAATGCGCTTTAGACATCTTTTTATCGTTTCTTGCAAGG
TCAGTCCCTGCTTTGGTACCCGATCTCGCTTTTGTGCAACATCAAAGTTACACTTACACA
GTAAAGCAGGAATCTTTATGGGACCGTTCGTACTGGTCAATTACTCCAGGCTTTGATTAA
TGGGTTTTAAGTTTTAACCGCAGATTTGGTACAAGTAACAACCTTTATTTACTTTTTATT
TCTGCAACTGTGTCTTTTAACATGAAAGAATCCAGCTCCATTCAAAAGTTTAGTTTTTAT
TTTCCATTGTGGTGCATGGTCACTCAGCCTGCAGTACTGAATTATCAAAATTTTCTTTTG
TCATTTCTCTCATGTTAAGTGCATAGTCTATTTTACTTCAACAGGTAGAAAAACTTTTGT
GGGTTTGTTTCTAGCTCAAGGAGGAAATTCATGGGTTTGCATCTAGCACATGAGAGAACA
ATATTGGTCTAACACAAAGCTCCTTTTGTAGGATGAGCTTCACTTCCTTGAAGGAGCTCA
GCCCGTTTCTCGTTCTGGATGCATTAAAGAGATAAATGAGTTTGTTGGTACAAAACATGA
CCCACTAATACCAACAAAGAGAAGGAGGCACAGATCTTGCCGTCTTTTTCGGTGGATCGG
ATCAAAATTGTGTATCTGCATTTCATGTCTTTGCTACTGTTGCAAGTGCTCACCCAAGTG
CAAAAGACCAAGGTGCCTCAATTGTTCTTGCAGCTCATGCTGCGACGAGCCATGCTGTAA
GCCAAACTGCAGTGCGTGCTGCGCTGGGTCATGCTGTAGTCCAGACTGCTGCTCATGCTG
TAAACCTAACTGCAGTTGCTGCAAGACCCCTTCTTGCTGCAAACCGAACTGCTCGTGCTC
CTGTCCAAGCTGCAGCTCATGCTGCGATACATCGTGCTGCAAACCGAGCTGCACCTGCTT
CAACATCTTTTCATGCTTCAAATCCCTGTACAGCTGCTTCAAGATCCCTTCATGCTTCAA
GTCCCAGTGCAACTGCTCTAGCCCCAATTGCTGCACTTGCACCCTTCCAAGCTGTAGCTG
CAAGGGCTGTGCCTGTCCAAGCTGTGGATGCAACGGCTGTGGCTGTCCAAGCTGCGGATG
CAACGGTTGTGGCTGTCCAAGCTGCGGTTGCAACGGCTGTGGCCTTCCAAGCTGCGGTTG
CAACGGCTGCGGCTCGTGCTCTTGCGCCCAATGCAAACCCGATTGTGGCTCGTGCTCTAC
CAATTGCTGTAGCTGCAAGCCAAGCTGCAACGGCTGCTGCGGCGAGCAGTGCTGCCGCTG
CGCGGACTGCTTCTCCTGCTCGTGCCCTCGTTGCTCCAGCTGCTTCAACATCTTCAAATG
CTCCTGCGCTGGCTGCTGCTCGAGCCTGTGCAAGTGCCCCTGCACGACGCAGTGCTTCAG
CTGCCAGTCGTCATGCTGCAAGCGGCAGCCTTCGTGCTGCAAGTGCCAGTCGTCTTGCTG
CGAGGGGCAGCCTTCCTGCTGCGAGGGACACTGCTGCAGCCTCCCGAAACCGTCGTGCCC
TGAATGTTCCTGTGGGTGTGTCTGGTCTTGCAAGAATTGTACAGAGGGTTGTCGATGCCC
ACGGTGTCGTAACCCATGCTGTCTCAGTGGTTGCTTATGTTGATCTAGATCCTTTTTTGG
TTGTTGTTTTTCTTGTATTTTTTAGTTGTTAGGCCTTTGATTAAGTTCGAACTTTCATAA
ATATATGGTGTTTATCCTGTAAAGAAATGATGATTTCAAGGATTTTTCATAGCTATGAGA
CGAGGTTGAACC

CDS

1152 bp

>Os09t0441900-03 Similar to Keratin associated protein.
GATGAGCTTCACTTCCTTGAAGGAGCTCAGCCCGTTTCTCGTTCTGGATGCATTAAAGAG
ATAAATGAGTTTGTTGGTACAAAACATGACCCACTAATACCAACAAAGAGAAGGAGGCAC
AGATCTTGCCGTCTTTTTCGGTGGATCGGATCAAAATTGTGTATCTGCATTTCATGTCTT
TGCTACTGTTGCAAGTGCTCACCCAAGTGCAAAAGACCAAGGTGCCTCAATTGTTCTTGC
AGCTCATGCTGCGACGAGCCATGCTGTAAGCCAAACTGCAGTGCGTGCTGCGCTGGGTCA
TGCTGTAGTCCAGACTGCTGCTCATGCTGTAAACCTAACTGCAGTTGCTGCAAGACCCCT
TCTTGCTGCAAACCGAACTGCTCGTGCTCCTGTCCAAGCTGCAGCTCATGCTGCGATACA
TCGTGCTGCAAACCGAGCTGCACCTGCTTCAACATCTTTTCATGCTTCAAATCCCTGTAC
AGCTGCTTCAAGATCCCTTCATGCTTCAAGTCCCAGTGCAACTGCTCTAGCCCCAATTGC
TGCACTTGCACCCTTCCAAGCTGTAGCTGCAAGGGCTGTGCCTGTCCAAGCTGTGGATGC
AACGGCTGTGGCTGTCCAAGCTGCGGATGCAACGGTTGTGGCTGTCCAAGCTGCGGTTGC
AACGGCTGTGGCCTTCCAAGCTGCGGTTGCAACGGCTGCGGCTCGTGCTCTTGCGCCCAA
TGCAAACCCGATTGTGGCTCGTGCTCTACCAATTGCTGTAGCTGCAAGCCAAGCTGCAAC
GGCTGCTGCGGCGAGCAGTGCTGCCGCTGCGCGGACTGCTTCTCCTGCTCGTGCCCTCGT
TGCTCCAGCTGCTTCAACATCTTCAAATGCTCCTGCGCTGGCTGCTGCTCGAGCCTGTGC
AAGTGCCCCTGCACGACGCAGTGCTTCAGCTGCCAGTCGTCATGCTGCAAGCGGCAGCCT
TCGTGCTGCAAGTGCCAGTCGTCTTGCTGCGAGGGGCAGCCTTCCTGCTGCGAGGGACAC
TGCTGCAGCCTCCCGAAACCGTCGTGCCCTGAATGTTCCTGTGGGTGTGTCTGGTCTTGC
AAGAATTGTACAGAGGGTTGTCGATGCCCACGGTGTCGTAACCCATGCTGTCTCAGTGGT
TGCTTATGTTGA

Protein

384 aa

>Os09t0441900-03 Similar to Keratin associated protein.
DELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISCL
CYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCCKTP
SCCKPNCSCSCPSCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNCSSPNC
CTCTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGCGSCSCAQ
CKPDCGSCSTNCCSCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCSCAGCCSSLC
KCPCTTQCFSCQSSCCKRQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSCPECSCGCVWSC
KNCTEGCRCPRCRNPCCLSGCLC*

5'UTR

chr09:16412084..16412894 (+ strand) : 811 bp

CDS

chr09:16412895..16412953 (+ strand) : 59 bp

chr09:16414109..16414153 (+ strand) : 45 bp

chr09:16414240..16414284 (+ strand) : 45 bp

chr09:16414700..16415702 (+ strand) : 1003 bp

3'UTR

chr09:16415703..16415851 (+ strand) : 149 bp

FASTA

>Os09t0441900-03 class=Sequence position=chr09:16412084..16415851 (+ strand)
GGAGAAAAGA AGAGCGTGGG CATGGACAAC TGACCTGAGT GGCCTTGTCA GGGAGAGCCA TAGCAGTGGA CGTGTCTATC
TCCGCCATTG CTTCGTCGAC ACTGGACGTG CAGACGGCAT GGCCATGAGG GCTTTGCACG ATGGGTGGTG CCGTGTTGGT
GTTATGGGCT GCCACCATGG TTTGAGGCTT TTGATGTTGC TAGATTTTGT GTTTAACGAG GGAGGGAAGA ATGTGTTGTT
CTTGACACTG TGCTGTGCTT TTAAGGAGCA GAGATTTCAG AAGCTCTTCA GATATCAGAG AACTTCTTTG TAGTAGTAAT
CAAATGCGCT TTAGACATCT TTTTATCGTT TCTTGCAAGG TCAGTCCCTG CTTTGGTACC CGATCTCGCT TTTGTGCAAC
ATCAAAGTTA CACTTACACA GTAAAGCAGG AATCTTTATG GGACCGTTCG TACTGGTCAA TTACTCCAGG CTTTGATTAA
TGGGTTTTAA GTTTTAACCG CAGATTTGGT ACAAGTAACA ACCTTTATTT ACTTTTTATT TCTGCAACTG TGTCTTTTAA
CATGAAAGAA TCCAGCTCCA TTCAAAAGTT TAGTTTTTAT TTTCCATTGT GGTGCATGGT CACTCAGCCT GCAGTACTGA
ATTATCAAAA TTTTCTTTTG TCATTTCTCT CATGTTAAGT GCATAGTCTA TTTTACTTCA ACAGGTAGAA AAACTTTTGT
GGGTTTGTTT CTAGCTCAAG GAGGAAATTC ATGGGTTTGC ATCTAGCACA TGAGAGAACA ATATTGGTCT AACACAAAGC
TCCTTTTGTA GGATGAGCTT CACTTCCTTG AAGGAGCTCA GCCCGTTTCT CGTTCTGGAT GCATTAAAGA GTATGTACTA
CTGCCCTTCA TGCATTACAG ATATTTTGTT TTTAAGTTTT TAGAAATTTG AAGAGCTTAT GTCAAGTATG AAATGTCAGC
TTAATTTTAT TGCTGTCCTT ATCTAATGTC TTATGCTCTG TTTTATAAAA TTTGGTTGCA TTTTCTCCCC CAGGGAAAAA
TCTTGTATAA GTGTGTTATG TACTTATGTG TATAAAATCT TGTTGCACTT GTATGTCACA CTTAggccct gtttagatcc
tccaaaatgg cagtttgcca ttttgaagaa ccttttgcca ttttggatct aaacactagt aacaaaactt ggcaatttgg
catttggcat ttgctagtct atagtagcaa attgtgccaa aaagtgcttt ggaaccactc tctctttctt tctctctctc
actttagtgc tagaatggta aaagtttagg atgcatctaa acaccaacta gtacttttac aatactaaaa cttttgccac
caaaactttt gccatttgcc atttgctatt tcaaatggat ctaaacaggg ccTTAGCAAA TCACCATATG TTAAAATTAC
CTTGGGATGA AAAAGAAAAA GGAAACCAGC ATTGAAGTCT TGTTTGAAAT GCATATGTAC TTGTACCATT ACAGAAATTC
TTAAAACTGC TGTCTTGACA GCTACTTATC AAACAGCCCC ACCTGCATCA TAACGTTCCT AGTGGTGCCT ATAACTCTGC
CTCAGTTATT ATTTTGTGGC CCACTGGTCC AACAATTTGA AAAAAATTAT ATTGAACTAA ATATATTGAA CAGTAGTATG
ACGTCCTCTT TGCTTGAGTT CCATATTACA GCTCACAGTC CTGAGATTTG TTTCACCGAT TCTTTCCATG CGATGTGCAC
ATATTCTTAT TCAATTTAAA AAATGAAAGC AGATTATTTT TAACAAGTAA CCTATCACGT TAGCTTAACA TTGTATATTT
GTGGTGGAAT TATGTAATAT TCCGATATCG CATTTGAAGT TTTGAACATG TGTGCTCAAA TTGAGGGACA CATGACTGTA
GTGAAAGCAA ATATAAATGT CTGAGCAATG GACTATACTT TGTATTCATT ACTACAAGTT ATGTCCTTTT GCAGGTTGCT
AATGTCCTCT TACATTACTT GTCAGGATAA ATGAGTTTGT TGGTACAAAA CATGACCCAC TAATACCAAC GTATGGCCTC
TAAACTTTCA GTTCCCCCAT TTTAAGCATG TTCGCTGTTT ATTTACGAGT TTTGACATTG TTTTTTCCTT TTCCAGAAAG
AGAAGGAGGC ACAGATCTTG CCGTCTTTTT CGGTGGATCG GGTATGTTTT GATCCAATAT AGTTTGCTCG CAGGTTCTGA
GGGGCAAGAA CATTCAAATA TCTATAATGT TTTCTGTTGG ATTCAACATT CATCACTATT TCCCTCGAAA AAAAAGCATT
CGTCACTATT GGAATTGAAA GTCTGAAAGT GCCTCTAGTC CCTTTGTATG TTAAAAGTCA ATAAACAAGC AGTAGTTTTC
TATATGCCAC ATTAATATTA TTGACGCATT TTAAAAAGCA AACTAGTCCA GGGATGTAAT CATCTTTGTT ATCTAAAACT
AAAAAAGGAA AAACTAGTGC TTTTTTACAT TAACATTGAT TTTTTTGCGG CTGAAATTAC ATGTAGAAAC TTTGGCATAA
TAATCTGTAC TACTGCCAAA CTGAGCTTTT ACATGGTGAA AATATTTTCC CTGCAGATCA AAATTGTGTA TCTGCATTTC
ATGTCTTTGC TACTGTTGCA AGTGCTCACC CAAGTGCAAA AGACCAAGGT GCCTCAATTG TTCTTGCAGC TCATGCTGCG
ACGAGCCATG CTGTAAGCCA AACTGCAGTG CGTGCTGCGC TGGGTCATGC TGTAGTCCAG ACTGCTGCTC ATGCTGTAAA
CCTAACTGCA GTTGCTGCAA GACCCCTTCT TGCTGCAAAC CGAACTGCTC GTGCTCCTGT CCAAGCTGCA GCTCATGCTG
CGATACATCG TGCTGCAAAC CGAGCTGCAC CTGCTTCAAC ATCTTTTCAT GCTTCAAATC CCTGTACAGC TGCTTCAAGA
TCCCTTCATG CTTCAAGTCC CAGTGCAACT GCTCTAGCCC CAATTGCTGC ACTTGCACCC TTCCAAGCTG TAGCTGCAAG
GGCTGTGCCT GTCCAAGCTG TGGATGCAAC GGCTGTGGCT GTCCAAGCTG CGGATGCAAC GGTTGTGGCT GTCCAAGCTG
CGGTTGCAAC GGCTGTGGCC TTCCAAGCTG CGGTTGCAAC GGCTGCGGCT CGTGCTCTTG CGCCCAATGC AAACCCGATT
GTGGCTCGTG CTCTACCAAT TGCTGTAGCT GCAAGCCAAG CTGCAACGGC TGCTGCGGCG AGCAGTGCTG CCGCTGCGCG
GACTGCTTCT CCTGCTCGTG CCCTCGTTGC TCCAGCTGCT TCAACATCTT CAAATGCTCC TGCGCTGGCT GCTGCTCGAG
CCTGTGCAAG TGCCCCTGCA CGACGCAGTG CTTCAGCTGC CAGTCGTCAT GCTGCAAGCG GCAGCCTTCG TGCTGCAAGT
GCCAGTCGTC TTGCTGCGAG GGGCAGCCTT CCTGCTGCGA GGGACACTGC TGCAGCCTCC CGAAACCGTC GTGCCCTGAA
TGTTCCTGTG GGTGTGTCTG GTCTTGCAAG AATTGTACAG AGGGTTGTCG ATGCCCACGG TGTCGTAACC CATGCTGTCT
CAGTGGTTGC TTATGTTGAT CTAGATCCTT TTTTGGTTGT TGTTTTTCTT GTATTTTTTA GTTGTTAGGC CTTTGATTAA
GTTCGAACTT TCATAAATAT ATGGTGTTTA TCCTGTAAAG AAATGATGAT TTCAAGGATT TTTCATAGCT ATGAGACGAG
GTTGAACC