Os09t0441900-04

Locus

Os09g0441900

Description

Similar to Truncated keratin associated protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DEP1

CGSNL Gene Name

DENSE AND ERECT PANICLE 1

Oryzabase Gene Symbol Synonym(s)

OsDEP1, EP, qPE9-1, DN1, DEP1/DN1/qPE9-1, qNGR9, qDEP1, RGG4/DEP1/DN1/qPE9-1/OsGGC3, RGG4, OsDN1, OsGGC3, GGC3

Oryzabase Gene Name Synonym(s)

dense and erect panicle 1, erect-pose panicle, DENSE PANICLE 1, DENSE AND ERECT PANICLE1, DENSE AND ERECT PANICLES 1, G gamma subunit DEP1, Heterotrimeric G Protein gamma4 Subunit

Transcript Evidence

AK062809 (DDBJ, Best hit)

Protein Evidence

B9VI84 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-107-D09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0441900-04)

RiceXPro (AK062809)

Others

Oryzabase (8503)

KEGG (Os09t0441900-04)

Transcript

515 bp

>Os09t0441900-04 Similar to Truncated keratin associated protein.
TAACAAGTAACCTATCACGTTAGCTTAACATTGTATATTTGTGGTGGAATTATGTAATAT
TCCGATATCGCATTTGAAGTTTTGAACATGTGTGCTCAAATTGAGGGACACATGACTGTA
GTGAAAGCAAATATAAATGTCTGAGCAATGGACTATACTTTGTATTCATTACTACAAGTT
ATGTCCTTTTGCAGGTTGCTAATGTCCTCTTACATTACTTGTCAGGATAAATGAGTTTGT
TGGTACAAAACATGACCCACTAATACCAACAAAGAGAAGGAGGCACAGATCTTGCCGTCT
TTTTCGGTGGATCGGGTATGTTTTGATCCAATATAGTTTGCTCGCAGGTTCTGAGGGGCA
AGAACATTCAAATATCTATAATGTTTTCTGTTGGATTCAACATTCATCACTATTTCCCTC
GAAAAAAAAGCATTCGTCACTATTGGAATTGAAAGTCTGAAAGTGCCTCTAGTCCCTTTG
TATGTTAAAAGTCAATAAACAAGCAGTAGTTTTCT

CDS

258 bp

>Os09t0441900-04 Similar to Truncated keratin associated protein.
TGTCCTCTTACATTACTTGTCAGGATAAATGAGTTTGTTGGTACAAAACATGACCCACTA
ATACCAACAAAGAGAAGGAGGCACAGATCTTGCCGTCTTTTTCGGTGGATCGGGTATGTT
TTGATCCAATATAGTTTGCTCGCAGGTTCTGAGGGGCAAGAACATTCAAATATCTATAAT
GTTTTCTGTTGGATTCAACATTCATCACTATTTCCCTCGAAAAAAAAGCATTCGTCACTA
TTGGAATTGAAAGTCTGA

Protein

86 aa

>Os09t0441900-04 Similar to Truncated keratin associated protein.
CPLTLLVRINEFVGTKHDPLIPTKRRRHRSCRLFRWIGYVLIQYSLLAGSEGQEHSNIYN
VFCWIQHSSLFPSKKKHSSLLELKV*

5'UTR

chr09:16413884..16414085 (+ strand) : 202 bp

CDS

chr09:16414086..16414153 (+ strand) : 68 bp

chr09:16414240..16414429 (+ strand) : 190 bp

3'UTR

chr09:16414430..16414484 (+ strand) : 55 bp

FASTA

>Os09t0441900-04 class=Sequence position=chr09:16413884..16414484 (+ strand)
TAACAAGTAA CCTATCACGT TAGCTTAACA TTGTATATTT GTGGTGGAAT TATGTAATAT TCCGATATCG CATTTGAAGT
TTTGAACATG TGTGCTCAAA TTGAGGGACA CATGACTGTA GTGAAAGCAA ATATAAATGT CTGAGCAATG GACTATACTT
TGTATTCATT ACTACAAGTT ATGTCCTTTT GCAGGTTGCT AATGTCCTCT TACATTACTT GTCAGGATAA ATGAGTTTGT
TGGTACAAAA CATGACCCAC TAATACCAAC GTATGGCCTC TAAACTTTCA GTTCCCCCAT TTTAAGCATG TTCGCTGTTT
ATTTACGAGT TTTGACATTG TTTTTTCCTT TTCCAGAAAG AGAAGGAGGC ACAGATCTTG CCGTCTTTTT CGGTGGATCG
GGTATGTTTT GATCCAATAT AGTTTGCTCG CAGGTTCTGA GGGGCAAGAA CATTCAAATA TCTATAATGT TTTCTGTTGG
ATTCAACATT CATCACTATT TCCCTCGAAA AAAAAGCATT CGTCACTATT GGAATTGAAA GTCTGAAAGT GCCTCTAGTC
CCTTTGTATG TTAAAAGTCA ATAAACAAGC AGTAGTTTTC T