Os09t0444500-01

Locus

Os09g0444500

Description

Similar to Protein Brevis radix-like 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

BRXL5

CGSNL Gene Name

BREVIS RADIX-LIKE 5

Oryzabase Gene Symbol Synonym(s)

OsBRXL5

Oryzabase Gene Name Synonym(s)

Brevis radix-like 5

Transcript Evidence

AK059606 (DDBJ, Best hit)

Protein Evidence

Q6YUB8 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-030-E12 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0444500-01)

RiceXPro (AK059606)

Others

Oryzabase (8932)

KEGG (Os09t0444500-01)

Transcript

502 bp

>Os09t0444500-01 Similar to Protein Brevis radix-like 1.
GTGCTCCTCCGCCTCTTCCTGCCATTAAGCACCAGATCCTAATCCGCCATTAATGCCCTT
AACTCCAAGCTCGATATCAGAGGAGGAAGAAGAGGCGTAGGAGTAGTACGGCTCCGCCGC
CTCCCTCCCCTGCCATTATAAGCTCACGCGCGGCGCTCGCCCGGGCGGCTCTGCCACCTG
TGACCTTGCTGTTGCTGTCACcggagaggcggaggggatgctcacgtgcatcgcgtgctc
gaagcagcccggcggcggcggcggggagccgctgcacgagccgccggaggacgaggacgc
cgtcgatggcggcggcggcggCGGCGGGGCGACGCCCAGCACGCGGCTGGCCATCAAGGC
GCTCACTGCGCAGGTGGGGTTCTCGGTACTTCACTCTCGAGAGTCGAGACTGTCACTGTG
TGTGCTTGAAGCTCTTCTTTTCTTATCCTGTTGATTAATTCAATGAAAAAGAAAAGAAAA
GAGAAGATGATGGTTTTGGTTC

CDS

237 bp

>Os09t0444500-01 Similar to Protein Brevis radix-like 1.
atgctcacgtgcatcgcgtgctcgaagcagcccggcggcggcggcggggagccgctgcac
gagccgccggaggacgaggacgccgtcgatggcggcggcggcggCGGCGGGGCGACGCCC
AGCACGCGGCTGGCCATCAAGGCGCTCACTGCGCAGGTGGGGTTCTCGGTACTTCACTCT
CGAGAGTCGAGACTGTCACTGTGTGTGCTTGAAGCTCTTCTTTTCTTATCCTGTTGA

Protein

79 aa

>Os09t0444500-01 Similar to Protein Brevis radix-like 1.
MLTCIACSKQPGGGGGEPLHEPPEDEDAVDGGGGGGGATPSTRLAIKALTAQVGFSVLHS
RESRLSLCVLEALLFLSC*

5'UTR

chr09:16552780..16552996 (+ strand) : 217 bp

CDS

chr09:16552997..16553233 (+ strand) : 237 bp

3'UTR

chr09:16553234..16553281 (+ strand) : 48 bp

FASTA

>Os09t0444500-01 class=Sequence position=chr09:16552780..16553281 (+ strand)
GTGCTCCTCC GCCTCTTCCT GCCATTAAGC ACCAGATCCT AATCCGCCAT TAATGCCCTT AACTCCAAGC TCGATATCAG
AGGAGGAAGA AGAGGCGTAG GAGTAGTACG GCTCCGCCGC CTCCCTCCCC TGCCATTATA AGCTCACGCG CGGCGCTCGC
CCGGGCGGCT CTGCCACCTG TGACCTTGCT GTTGCTGTCA Ccggagaggc ggaggggatg ctcacgtgca tcgcgtgctc
gaagcagccc ggcggcggcg gcggggagcc gctgcacgag ccgccggagg acgaggacgc cgtcgatggc ggcggcggcg
gCGGCGGGGC GACGCCCAGC ACGCGGCTGG CCATCAAGGC GCTCACTGCG CAGGTGGGGT TCTCGGTACT TCACTCTCGA
GAGTCGAGAC TGTCACTGTG TGTGCTTGAA GCTCTTCTTT TCTTATCCTG TTGATTAATT CAATGAAAAA GAAAAGAAAA
GAGAAGATGA TGGTTTTGGT TC