Os09t0456100-01

Locus

Os09g0456100

Description

Remorin_C-containing protein, Control of panicle length

RAP-DB Gene Symbol Synonym(s)

LP1

RAP-DB Gene Name Synonym(s)

LONG PANICLE 1

CGSNL Gene Symbol

REM5.3

CGSNL Gene Name

REMORIN 5.3

Oryzabase Gene Symbol Synonym(s)

OsREM5.3

Oryzabase Gene Name Synonym(s)

Remorin 5.3, remorin group 5 member 3

Transcript Evidence

AK072474

Protein Evidence

Q67TQ6

Literature

PMID: 27200064

Note

Manual Curation

September 12, 2017

Functional domain (InterPro)

Remorin, C-terminal (IPR005516)

Full-length cDNA

J023121I15 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0456100-01)

RiceXPro (AK072474)

Others

Oryzabase (20277)

KEGG (Os09t0456100-01)

Transcript

2845 bp

>Os09t0456100-01 Remorin_C-containing protein, Control of panicle length
GGCTCGCGTCAGACAGACTCCCTCCTCTCCTCGAGATGCTGTACTTGCCATCGGTCCATC
ACCCTTCCATCCCGCCACGTTGCGATCCCCTCGGCCACTTCTATTAAACGCCAACGTACT
CCTCATCACGCCTCCAAACCCGCCGCTTTGATTGTACTTGTGCTTTGCTGTTAAAGAGCT
CGCCGGCGTGAGTGGTGGCGGGTAGAAGTTATATGGAGAGAATGCGGTGTGTTGGTGGTG
GTGACACCCCGTTGGGGTTTCGGGGCGTCGTGGAGGAGGAGCTAGAGGAGGAGGTGGCGG
CGGTGTCAGCGTCGGGGAGGCCAATGCAGCGGCAGCGGCGGCGGCGGCGGCGGTGGGGAG
AGGATGCCGACGATGGCTACTCGGCGAGCTCGACTGGCGGCGGCGGGAGCAGCGGATGCG
GCTCCTTCGGCTGTGACTCGCCTTTGGCTGGGTTCGTGCGTGCTGATGGCGACCCGGACA
CAGATCTGGAGACAGATGGGGTGGCCACTCCATCCTCCAATGCCTCTGCAGCATTCGCCG
AGCCACACGACGAGGAGGAGGGGGACGAGGTGTTGTGTGGGGTGGTGGAAGGGGACTGGG
CACAGCTGCAAGAACCAACCAAGAGTCCGGCAGACCGTACCACCGGAGAATGCCTGTACC
AGCGGCGCCGGTCAGAAGCTGTTCTTTTGCAGGGTAGGAAGGGGTTGAAGCAACGGCCAG
CCTCTCTGGACTTTGGCAGCGGCAGCCCCGGGTTCAATGGAGCCCCTCTTTCTCCGGGCT
TTGTGGTTGGGGGTGTGGGTTTGATGAACAAGGGTCTTGTGTCATCATCATTCATCAGAT
CAGACGTTTTTCCTAGTCCCAGGACACCGAACTATCGGCGGCATCGTTCATCAGTATTTG
GTTACCAAAAGGGGTGGAGCTCTGAGAGAGTACCGCTTGCTTCCAAAGGTAACAGGAGGT
ACCCAGGCAGCAGCATGGCATTTCCCTTCAGCAATGGGAGGACATTGCCCTCCAAATGGG
AGGATGCAGAGAGATGGATCTTCAGTCCGAATTCGAGTGACGTGCTCGAGAAGACTTCAT
TTGCTCCTGCTCGGCGACCAAAGTCCAAAAGTGGTCCATTAGGGCCTCCTGGAAAATTTG
GTGGACAATACTCATCTGTGTCATTGCTTGACAATGGGAGAGTTGGACATTTGACAGCAA
ACTCGCCTTTCTTGGCTGGAGTACTGATACCAGAACATTATTGTGGAGAGAAAGATAACA
TTGGGAGGTATATGAGCAGAACAGCTGGTGAGGAGGCCAGCATTGGCATTGGAGGCAAGT
CTTGTCTGGCAAATGGTGGGTCTCATGCTACTCAATATAACAGAGTTCGTCGACGACTGG
ATACTGCGATTGAGTCATCACCTTCATTGCCTAGCACCCAAGCGTCTGTACAAGATGAAC
AGGTTGGAATCACAGAAGAGTCAGCCTCCATTATCACCCCTATAATTTTGCGGAAGGATG
CGGCAACTCAAACAAGCCCAAATCTAAGTCGGTCATCTTCGCCCAGTGTCAGTACTCCAT
TTATCCATTTGCTTACGACACACCAAGTCAGAGAAAAGGAGAATTGTTTCTCTGATGTTA
TCAGGGATGTGCACATGGACGATCGAGTGACTCTTACCAGGTGGTCCAAGAAACATGTTA
CACGAGCATCTAGCAAGAACTCAACAAATGTTATAGATGTGAAGAAAAAGACAGTGGAGT
CTAAGTCTTCTTCCTGGGAATTAACAGAAGCAAAATCCATATCAAAGGTTGAGCGAGAGC
AAGAAAAAATTACTGCTTGGGAACACCTCCAAAAAGCCAAGGCTGAGGCAGCAATCCAAA
AGTTAGTGATGAAAATCGAGAAAAAGAGATCATCTTCACTGGACAAGATTTGGAACACCC
TCAGGTCTGCACAAAGAAGAGCACAGGTAATGCGTGAAACTGCAGCAGCAAACCAGGATG
AGCAATCTTCCGGGAAGGCTAAAAGGACATCACACCTTAATAAGAACGGCCAGATCAGCT
CTCTGAGTGGCTGCTTCACTTGCCATGCCTTCTAGTGTCATGTAGTTTAAGAAGGAACAG
GACTTAAAGTAATTCTTCGTGTTATCAACACGCTCGTGTTGACTTAGTGAAGTTCAGAGA
TTTACAGAATAAAGATGATCCAGCAGATGGAAATTATCCCCCCTTGAATTTTGACAAGAT
GCTGCTGCAACAATGGGGGACCATGCATTATCATGATATAGATTTCTACAGTTCTGCTTT
GTGTTAGTTTCGATTCTGCCATGGGGGGACAAGAGAAAATGGTGCCACGAAGGAAAGGTG
AAATTCTTCTGCATACATCCCATGTGCCTGATTGATATCTTAGCACAATGATAATTGATA
AGGTCCTCCTCTATCATTCATTACCCATTACCAACATTCTAGATGCTATGAGTTTGTGTG
CGATGAAAACAAAGCAGATATGTATCATTTGCACCACAATTCCAACGGATAGATAAGAAG
GGAATGTTTCAGTCAGAGGGAATACAGTGCCTTACTGTGATTCATGCTGGAAAACTCTAC
TGGATTGTGAAAGGGAACCAGGTGGAATGCAATAGATTTAGCTAGCGTATGCTACATTTG
CATACACAGTTACAATAGCATGTGTTGGAGAAAAATATAGGAATACAGGAAAATAGAGAT
TCTGTTTGAATTTCATGGCAATTTGACAAGCTCTTCGCAGAACAACTCTCCCATTTCTGT
AATGAGCTGTTTCTTGTAATTCCTATTGCAACACATAGGCGTTACTGAATGTTGATAAAT
GATATTGCCATCGCAATTTTTTTTT

CDS

1863 bp

>Os09t0456100-01 Remorin_C-containing protein, Control of panicle length
ATGGAGAGAATGCGGTGTGTTGGTGGTGGTGACACCCCGTTGGGGTTTCGGGGCGTCGTG
GAGGAGGAGCTAGAGGAGGAGGTGGCGGCGGTGTCAGCGTCGGGGAGGCCAATGCAGCGG
CAGCGGCGGCGGCGGCGGCGGTGGGGAGAGGATGCCGACGATGGCTACTCGGCGAGCTCG
ACTGGCGGCGGCGGGAGCAGCGGATGCGGCTCCTTCGGCTGTGACTCGCCTTTGGCTGGG
TTCGTGCGTGCTGATGGCGACCCGGACACAGATCTGGAGACAGATGGGGTGGCCACTCCA
TCCTCCAATGCCTCTGCAGCATTCGCCGAGCCACACGACGAGGAGGAGGGGGACGAGGTG
TTGTGTGGGGTGGTGGAAGGGGACTGGGCACAGCTGCAAGAACCAACCAAGAGTCCGGCA
GACCGTACCACCGGAGAATGCCTGTACCAGCGGCGCCGGTCAGAAGCTGTTCTTTTGCAG
GGTAGGAAGGGGTTGAAGCAACGGCCAGCCTCTCTGGACTTTGGCAGCGGCAGCCCCGGG
TTCAATGGAGCCCCTCTTTCTCCGGGCTTTGTGGTTGGGGGTGTGGGTTTGATGAACAAG
GGTCTTGTGTCATCATCATTCATCAGATCAGACGTTTTTCCTAGTCCCAGGACACCGAAC
TATCGGCGGCATCGTTCATCAGTATTTGGTTACCAAAAGGGGTGGAGCTCTGAGAGAGTA
CCGCTTGCTTCCAAAGGTAACAGGAGGTACCCAGGCAGCAGCATGGCATTTCCCTTCAGC
AATGGGAGGACATTGCCCTCCAAATGGGAGGATGCAGAGAGATGGATCTTCAGTCCGAAT
TCGAGTGACGTGCTCGAGAAGACTTCATTTGCTCCTGCTCGGCGACCAAAGTCCAAAAGT
GGTCCATTAGGGCCTCCTGGAAAATTTGGTGGACAATACTCATCTGTGTCATTGCTTGAC
AATGGGAGAGTTGGACATTTGACAGCAAACTCGCCTTTCTTGGCTGGAGTACTGATACCA
GAACATTATTGTGGAGAGAAAGATAACATTGGGAGGTATATGAGCAGAACAGCTGGTGAG
GAGGCCAGCATTGGCATTGGAGGCAAGTCTTGTCTGGCAAATGGTGGGTCTCATGCTACT
CAATATAACAGAGTTCGTCGACGACTGGATACTGCGATTGAGTCATCACCTTCATTGCCT
AGCACCCAAGCGTCTGTACAAGATGAACAGGTTGGAATCACAGAAGAGTCAGCCTCCATT
ATCACCCCTATAATTTTGCGGAAGGATGCGGCAACTCAAACAAGCCCAAATCTAAGTCGG
TCATCTTCGCCCAGTGTCAGTACTCCATTTATCCATTTGCTTACGACACACCAAGTCAGA
GAAAAGGAGAATTGTTTCTCTGATGTTATCAGGGATGTGCACATGGACGATCGAGTGACT
CTTACCAGGTGGTCCAAGAAACATGTTACACGAGCATCTAGCAAGAACTCAACAAATGTT
ATAGATGTGAAGAAAAAGACAGTGGAGTCTAAGTCTTCTTCCTGGGAATTAACAGAAGCA
AAATCCATATCAAAGGTTGAGCGAGAGCAAGAAAAAATTACTGCTTGGGAACACCTCCAA
AAAGCCAAGGCTGAGGCAGCAATCCAAAAGTTAGTGATGAAAATCGAGAAAAAGAGATCA
TCTTCACTGGACAAGATTTGGAACACCCTCAGGTCTGCACAAAGAAGAGCACAGGTAATG
CGTGAAACTGCAGCAGCAAACCAGGATGAGCAATCTTCCGGGAAGGCTAAAAGGACATCA
CACCTTAATAAGAACGGCCAGATCAGCTCTCTGAGTGGCTGCTTCACTTGCCATGCCTTC
TAG

Protein

621 aa

>Os09t0456100-01 Remorin_C-containing protein, Control of panicle length
MERMRCVGGGDTPLGFRGVVEEELEEEVAAVSASGRPMQRQRRRRRRWGEDADDGYSASS
TGGGGSSGCGSFGCDSPLAGFVRADGDPDTDLETDGVATPSSNASAAFAEPHDEEEGDEV
LCGVVEGDWAQLQEPTKSPADRTTGECLYQRRRSEAVLLQGRKGLKQRPASLDFGSGSPG
FNGAPLSPGFVVGGVGLMNKGLVSSSFIRSDVFPSPRTPNYRRHRSSVFGYQKGWSSERV
PLASKGNRRYPGSSMAFPFSNGRTLPSKWEDAERWIFSPNSSDVLEKTSFAPARRPKSKS
GPLGPPGKFGGQYSSVSLLDNGRVGHLTANSPFLAGVLIPEHYCGEKDNIGRYMSRTAGE
EASIGIGGKSCLANGGSHATQYNRVRRRLDTAIESSPSLPSTQASVQDEQVGITEESASI
ITPIILRKDAATQTSPNLSRSSSPSVSTPFIHLLTTHQVREKENCFSDVIRDVHMDDRVT
LTRWSKKHVTRASSKNSTNVIDVKKKTVESKSSSWELTEAKSISKVEREQEKITAWEHLQ
KAKAEAAIQKLVMKIEKKRSSSLDKIWNTLRSAQRRAQVMRETAAANQDEQSSGKAKRTS
HLNKNGQISSLSGCFTCHAF*

5'UTR

chr09:17182867..17183078 (+ strand) : 212 bp

CDS

chr09:17183079..17183306 (+ strand) : 228 bp

chr09:17183901..17183982 (+ strand) : 82 bp

chr09:17184090..17184215 (+ strand) : 126 bp

chr09:17184297..17185082 (+ strand) : 786 bp

chr09:17185394..17185745 (+ strand) : 352 bp

chr09:17186118..17186199 (+ strand) : 82 bp

chr09:17186407..17186613 (+ strand) : 207 bp

3'UTR

chr09:17186614..17186631 (+ strand) : 18 bp

chr09:17187564..17188315 (+ strand) : 752 bp

FASTA

>Os09t0456100-01 class=Sequence position=chr09:17182867..17188315 (+ strand)
GGCTCGCGTC AGACAGACTC CCTCCTCTCC TCGAGATGCT GTACTTGCCA TCGGTCCATC ACCCTTCCAT CCCGCCACGT
TGCGATCCCC TCGGCCACTT CTATTAAACG CCAACGTACT CCTCATCACG CCTCCAAACC CGCCGCTTTG ATTGTACTTG
TGCTTTGCTG TTAAAGAGCT CGCCGGCGTG AGTGGTGGCG GGTAGAAGTT ATATGGAGAG AATGCGGTGT GTTGGTGGTG
GTGACACCCC GTTGGGGTTT CGGGGCGTCG TGGAGGAGGA GCTAGAGGAG GAGGTGGCGG CGGTGTCAGC GTCGGGGAGG
CCAATGCAGC GGCAGCGGCG GCGGCGGCGG CGGTGGGGAG AGGATGCCGA CGATGGCTAC TCGGCGAGCT CGACTGGCGG
CGGCGGGAGC AGCGGATGCG GCTCCTTCGG CTGTGACTCG GTTCGTCTTG CTCCCTGCAT CGCTAGTACT ACTTTTTTTG
TTGATTTCCT TTAGCATTAG TCATGGGCGA TTTCTTTCTT TTTCTTGGGC ACCAAACTCT GCAATTTGCG CCATGAGGAA
GAAAAAGATT GTTAATTTTG AGATGCTATT CACCTCAGTT AAGGAAAAGA TTTAACTTTA CAGGGTGGTT GTTGCCACTT
GCCAATGTGC CACGCAGATC TCAGTAGCAG ATAGCTTTTC TCAGGTGACA GCAAGTTCGC AACAACGCGT TTAGATGCGA
TAGTATAATC AAGAAACACC ATGCTAAGTA AACTGCAAAA TCTTTATAAA TAACTAGCGA AATGCCTAGT TGGTAATTCT
AGCAATTGAG ACAAAGCAGG AGGGCCCAGA CCTTTTTAAG ACAGTAGGAA TCAATGCATC ATCGTCACCA TCTTGGATCC
TTAGCAAGAG GAGAAAGGAG GGTGCTTTTT TCCTTGACAT GAGAAAATGG GGGCTCTGTT GCCTGTTGGA TTCTCTTCAC
CTTTGTTCTC TGTTTGAGAA TTAGTAGGTA CTAGCTTTTA TGATCAGTGA GGCTAAGCTG ATGGTTGGTT GCAGCCTTTG
GCTGGGTTCG TGCGTGCTGA TGGCGACCCG GACACAGATC TGGAGACAGA TGGGGTGGCC ACTCCATCCT CCAATGGTGA
GCACAATGCT GTTCACAGCT CACAGTTTGT ATTCTTGCCA GTGTTCTTGC TCGGTTGGAG CGCAACTTTA CAGCCCTTAA
AAGGAGTTCT GTTCTCGCTG AAGCCTCTGC AGCATTCGCC GAGCCACACG ACGAGGAGGA GGGGGACGAG GTGTTGTGTG
GGGTGGTGGA AGGGGACTGG GCACAGCTGC AAGAACCAAC CAAGAGTCCG GCAGACCGTA CCACCGGAGG TACGAATTCT
GAAACTTTGC ATGGAAAAAT TTAGATGGTA CTCGGTTGTT CATTTTGTAT GCTTGTGTGG TGCTCGACAG AATGCCTGTA
CCAGCGGCGC CGGTCAGAAG CTGTTCTTTT GCAGGGTAGG AAGGGGTTGA AGCAACGGCC AGCCTCTCTG GACTTTGGCA
GCGGCAGCCC CGGGTTCAAT GGAGCCCCTC TTTCTCCGGG CTTTGTGGTT GGGGGTGTGG GTTTGATGAA CAAGGGTCTT
GTGTCATCAT CATTCATCAG ATCAGACGTT TTTCCTAGTC CCAGGACACC GAACTATCGG CGGCATCGTT CATCAGTATT
TGGTTACCAA AAGGGGTGGA GCTCTGAGAG AGTACCGCTT GCTTCCAAAG GTAACAGGAG GTACCCAGGC AGCAGCATGG
CATTTCCCTT CAGCAATGGG AGGACATTGC CCTCCAAATG GGAGGATGCA GAGAGATGGA TCTTCAGTCC GAATTCGAGT
GACGTGCTCG AGAAGACTTC ATTTGCTCCT GCTCGGCGAC CAAAGTCCAA AAGTGGTCCA TTAGGGCCTC CTGGAAAATT
TGGTGGACAA TACTCATCTG TGTCATTGCT TGACAATGGG AGAGTTGGAC ATTTGACAGC AAACTCGCCT TTCTTGGCTG
GAGTACTGAT ACCAGAACAT TATTGTGGAG AGAAAGATAA CATTGGGAGG TATATGAGCA GAACAGCTGG TGAGGAGGCC
AGCATTGGCA TTGGAGGCAA GTCTTGTCTG GCAAATGGTG GGTCTCATGC TACTCAATAT AACAGAGTTC GTCGACGACT
GGATACTGCG ATTGAGTCAT CACCTTCATT GCCTAGCACC CAAGCGTCTG TACAAGGTAT TATAAATTAT TCTCGTTTGC
AATTCATTCC TTTTCTGCCT GCCTTTCAGT TTTGAGTTGA TCCATAATTG TTCTGAAGGC AGCCTGGTGT TTTGAGGTAT
CCTCTCTATT TGCCAAAGCA TCTCAATACT GTGGAGTTTC TCATGGCCTT GCCACTGTAA ATGATGTTTT TTTTGTCAAT
TAGTGTTTTG ATAGCTGGTT TTATCCTTGG ATCGTCAACA TAACATCATA GAAAGTTAGT CTTATTCTGT ACACAACAGA
TCAAGTCAGT CTTATGTTTG TACCTTCTTG TTTGGTTTCT GATTCAGATG AACAGGTTGG AATCACAGAA GAGTCAGCCT
CCATTATCAC CCCTATAATT TTGCGGAAGG ATGCGGCAAC TCAAACAAGC CCAAATCTAA GTCGGTCATC TTCGCCCAGT
GTCAGTACTC CATTTATCCA TTTGCTTACG ACACACCAAG TCAGAGAAAA GGAGAATTGT TTCTCTGATG TTATCAGGGA
TGTGCACATG GACGATCGAG TGACTCTTAC CAGGTGGTCC AAGAAACATG TTACACGAGC ATCTAGCAAG AACTCAACAA
ATGTTATAGA TGTGAAGAAA AAGACAGTGG AGTCTAAGTC TTCTTCCTGG GAATTAACAG AAGCAAAATC CATATCAAAG
TAAGAGACCA CCAATTGTTT TGGTCCTACA GATGAGTTTG AGTAGCATTT TCTTCGGACA TAACTTTATT ATGTTGAACC
ACTAAATTAC TAACAGAAGC AAAATCCATA TCAAAGTAAG AGACCACCAA TTGTTTTGGT CCTTCAGATG AGTTTGAGTA
GTATTTTCTT CAGACATAAC TTTGTTACGT TGAACCACTA AATTACTACT ATAAGACTTG AAAGATTAAT TTAGGGAAAG
AATGCTGCAT GTCTTTCTTA TCTGTTATAG TACGCAAGTT ATCCAATGCT TTTAATATTT TCCAAAAACT TGCAACTTAA
ATTTACACCA TCAAGCCGTG AAATGCTAAT CACTCCATGC AATGTTAAAA GGGTTGAGCG AGAGCAAGAA AAAATTACTG
CTTGGGAACA CCTCCAAAAA GCCAAGGCTG AGGCAGCAAT CCAAAAGTTA GTGGTATGTG TGCTCTTTTC TTTACTTCTT
TACTTCTAAC AGATTTATAG GTCTGTTTTA TCGGACTTAT TTATGTTGTT GTAAAGAGCC TATATACTGT ATACACGACC
AAAATTCTCA AAGTTAAATC AACGCTCATG TAAATCACTG GATTCTTTTC CACTGATGTA CATTTGACCT TACACTATAC
GCATGCTTTT GTTATGTCAG ATGAAAATCG AGAAAAAGAG ATCATCTTCA CTGGACAAGA TTTGGAACAC CCTCAGGTCT
GCACAAAGAA GAGCACAGGT AATGCGTGAA ACTGCAGCAG CAAACCAGGA TGAGCAATCT TCCGGGAAGG CTAAAAGGAC
ATCACACCTT AATAAGAACG GCCAGATCAG CTCTCTGAGT GGCTGCTTCA CTTGCCATGC CTTCTAGTGT CATGTAGTTT
AAGAAGTGAG TAAGTTACAT TCTGACTCCT GTGATACTTT AAATGTTTTT TGATGAATTC TGCAGTGTTT CCTGTTTTAA
TAACATTATA CCTGTTAGGA TTTTTTTCAC AGTACACCAA AATTGTTTAG ATAGTTCATT TAACACTGGT CCAACGCTTG
ATAATACTAT TACCTCCTAC AGGATCTAAC TGTTAACATT ACAGCAGTAT CATTATTGAG ATCTAACAGT TGCAACTGGG
AGAATTATGT AAAGAATAAA TTCCCCAGTA CCCTCTTCTG AGTATCATCG AGGGGAACAA TTACATTTAT TTTAGAGCAC
CGATGATGCG TGCATATTAT TTTAGTTTAT TTCACCTACC TTGATGTAGA TATTTTTTTT TTTGTAACTG CATACCATTC
ACTCAAATAA CTTTTCAGAA TTATGTTATG CTCTATGACA TATTCCATGT TTCAAACCAA TTATTCAGAT TACGTAGATC
CTAAAGGTAT ACCTGTATTC ATAAACTTCT TCGATGCAAC TAGCGGATTG ACCTTTAGTG GAGGGGTACC AGCTTAGGTT
GTACAGTCAG CATTATCCTA CTAAATTGCC TCAAATTTAT TTAGGTCCTT CTTAAATAAG TAATCATACA CATCTGTCTT
CTAATTAACA TTGATAGAAT TCTTGTTAGT ATGCTGAAGA CGTGAACAGT TTGCTACTGT TTACCTTGTA ATGTTTTGAG
GAAAATCGAC AATATTATGA TAACAAAAAG GGGTCAATTA TTAGCATGCG TACTAATATA TTTCCTGTAA TCTGTGGCTG
TCTGATACCA CATGTTTACC CTTTTACTGT TGATGCCCCA CAACTTCCAT ATCGGCTCAA TAATTAGGCA ACATTTCAGT
GAACCAAATA TTCCATGCAT GCTTATGTTT GTACATCAAA ACTTTTGTCA TGTTCAGGGA ACAGGACTTA AAGTAATTCT
TCGTGTTATC AACACGCTCG TGTTGACTTA GTGAAGTTCA GAGATTTACA GAATAAAGAT GATCCAGCAG ATGGAAATTA
TCCCCCCTTG AATTTTGACA AGATGCTGCT GCAACAATGG GGGACCATGC ATTATCATGA TATAGATTTC TACAGTTCTG
CTTTGTGTTA GTTTCGATTC TGCCATGGGG GGACAAGAGA AAATGGTGCC ACGAAGGAAA GGTGAAATTC TTCTGCATAC
ATCCCATGTG CCTGATTGAT ATCTTAGCAC AATGATAATT GATAAGGTCC TCCTCTATCA TTCATTACCC ATTACCAACA
TTCTAGATGC TATGAGTTTG TGTGCGATGA AAACAAAGCA GATATGTATC ATTTGCACCA CAATTCCAAC GGATAGATAA
GAAGGGAATG TTTCAGTCAG AGGGAATACA GTGCCTTACT GTGATTCATG CTGGAAAACT CTACTGGATT GTGAAAGGGA
ACCAGGTGGA ATGCAATAGA TTTAGCTAGC GTATGCTACA TTTGCATACA CAGTTACAAT AGCATGTGTT GGAGAAAAAT
ATAGGAATAC AGGAAAATAG AGATTCTGTT TGAATTTCAT GGCAATTTGA CAAGCTCTTC GCAGAACAAC TCTCCCATTT
CTGTAATGAG CTGTTTCTTG TAATTCCTAT TGCAACACAT AGGCGTTACT GAATGTTGAT AAATGATATT GCCATCGCAA
TTTTTTTTT

Locus: Os09g0456100

Loading...

Locus: Os09g0456100

Loading...