Os09t0456100-02

Locus

Os09g0456100

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

REM5.3

CGSNL Gene Name

REMORIN 5.3

Oryzabase Gene Symbol Synonym(s)

OsREM5.3

Oryzabase Gene Name Synonym(s)

Remorin 5.3, remorin group 5 member 3

Transcript Evidence

AK073880 (DDBJ, Best hit)

Protein Evidence

B8BCK7 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Remorin, C-terminal (IPR005516)

Full-length cDNA

J033071G17 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0456100-02)

RiceXPro (AK073880)

Others

Oryzabase (20277)

KEGG (Os09t0456100-02)

Transcript

2316 bp

>Os09t0456100-02 Hypothetical conserved gene.
AGCATTCGCCGAGCCACACGACGAGGAGGAGGGGGACGAGGTGTTGTGTGGGGTGGTGGA
AGGGGACTGGGCACAGCTGCAAGAACCAACCAAGAGTCCGGCAGACCGTACCACCGGAGA
ATGCCTGTACCAGCGGCGCCGGTCAGAAGCTGTTCTTTTGCAGGGTAGGAAGGGGTTGAA
GCAACGGCCAGCCTCTCTGGACTTTGGCAGCGGCAGCCCCGGGTTCAATGGAGCCCCTCT
TTCTCCGGGCTTTGTGGTTGGGGGTGTGGGTTTGATGAACAAGGGTCTTGTGTCATCATC
ATTCATCAGATCAGACGTTTTTCCTAGTCCCAGGACACCGAACTATCGGCGGCATCGTTC
ATCAGTATTTGGTTACCAAAAGGGGTGGAGCTCTGAGAGAGTACCGCTTGCTTCCAAAGG
TAACAGGAGGTACCCAGGCAGCAGCATGGCATTTCCCTTCAGCAATGGGAGGACATTGCC
CTCCAAATGGGAGGATGCAGAGAGATGGATCTTCAGTCCGAATTCGAGTGACGTGCTCGA
GAAGACTTCATTTGCTCCTGCTCGGCGACCAAAGTCCAAAAGTGGTCCATTAGGGCCTCC
TGGAAAATTTGGTGGACAATACTCATCTGTGTCATTGCTTGACAATGGGAGAGTTGGACA
TTTGACAGCAAACTCGCCTTTCTTGGCTGGAGTACTGATACCAGAACATTATTGTGGAGA
GAAAGATAACATTGGGAGGTATATGAGCAGAACAGCTGGTGAGGAGGCCAGCATTGGCAT
TGGAGGCAAGTCTTGTCTGGCAAATGGTGGGTCTCATGCTACTCAATATAACAGAGTTCG
TCGACGACTGGATACTGCGATTGAGTCATCACCTTCATTGCCTAGCACCCAAGCGTCTGT
ACAAGATGAACAGGTTGGAATCACAGAAGAGTCAGCCTCCATTATCACCCCTATAATTTT
GCGGAAGGATGCGGCAACTCAAACAAGCCCAAATCTAAGTCGGTCATCTTCGCCCAGTGT
CAGTACTCCATTTATCCATTTGCTTACGACACACCAAGTCAGAGAAAAGGAGAATTGTTT
CTCTGATGTTATCAGGGATGTGCACATGGACGATCGAGTGACTCTTACCAGGTGGTCCAA
GAAACATGTTACACGAGCATCTAGCAAGAACTCAACAAATGTTATAGATGTGAAGAAAAA
GACAGTGGAGTCTAAGTCTTCTTCCTGGGAATTAACAGAAGCAAAATCCATATCAAAGGT
TGAGCGAGAGCAAGAAAAAATTACTGCTTGGGAACACCTCCAAAAAGCCAAGGCTGAGGC
AGCAATCCAAAAGTTAGTGATGAAAATCGAGAAAAAGAGATCATCTTCACTGGACAAGAT
TTGGAACACCCTCAGGTCTGCACAAAGAAGAGCACAGGTAATGCGTGAAACTGCAGCAGC
AAACCAGGATGAGCAATCTTCCGGGAAGGCTAAAAGGACATCACACCTTAATAAGAACGG
CCAGATCAGCTCTCTGAGTGGCTGCTTCACTTGCCATGCCTTCTAGTGTCATGTAGTTTA
AGAAGGAACAGGACTTAAAGTAATTCTTCGTGTTATCAACACGCTCGTGTTGACTTAGTG
AAGTTCAGAGATTTACAGAATAAAGATGATCCAGCAGATGGAAATTATCCCCCCTTGAAT
TTTGACAAGATGCTGCTGCAACAATGGGGGACCATGCATTATCATGATATAGATTTCTAC
AGTTCTGCTTTGTGTTAGTTTCGATTCTGCCATGGGGGGACAAGAGAAAATGGTGCCACG
AAGGAAAGGTGAAATTCTTCTGCATACATCCCATGTGCCTGATTGATATCTTAGCACAAT
GATAATTGATAAGGTCCTCCTCTATCATTCATTACCCATTACCAACATTCTAGATGCTAT
GAGTTTGTGTGCGATGAAAACAAAGCAGATATGTATCATTTGCACCACAATTCCAACGGA
TAGATAAGAAGGGAATGTTTCAGTCAGAGGGAATACAGTGCCTTACTGTGATTCATGCTG
GAAAACTCTACTGGATTGTGAAAGGGAACCAGGTGGAATGCAATAGATTTAGCTAGCGTA
TGCTACATTTGCATACACAGTTACAATAGCATGTGTTGGAGAAAAATATAGGAATACAGG
AAAATAGAGATTCTGTTTGAATTTCATGGCAATTTGACAAGCTCTTCGCAGAACAACTCT
CCCATTTCTGTAATGAGCTGTTTCTTGTAATTCCTATTGCAACACATAGGCGTTACTGAA
TGTTGATAAATGATATTGCCATCGCAATTTTTTTTT

CDS

1545 bp

>Os09t0456100-02 Hypothetical conserved gene.
GCATTCGCCGAGCCACACGACGAGGAGGAGGGGGACGAGGTGTTGTGTGGGGTGGTGGAA
GGGGACTGGGCACAGCTGCAAGAACCAACCAAGAGTCCGGCAGACCGTACCACCGGAGAA
TGCCTGTACCAGCGGCGCCGGTCAGAAGCTGTTCTTTTGCAGGGTAGGAAGGGGTTGAAG
CAACGGCCAGCCTCTCTGGACTTTGGCAGCGGCAGCCCCGGGTTCAATGGAGCCCCTCTT
TCTCCGGGCTTTGTGGTTGGGGGTGTGGGTTTGATGAACAAGGGTCTTGTGTCATCATCA
TTCATCAGATCAGACGTTTTTCCTAGTCCCAGGACACCGAACTATCGGCGGCATCGTTCA
TCAGTATTTGGTTACCAAAAGGGGTGGAGCTCTGAGAGAGTACCGCTTGCTTCCAAAGGT
AACAGGAGGTACCCAGGCAGCAGCATGGCATTTCCCTTCAGCAATGGGAGGACATTGCCC
TCCAAATGGGAGGATGCAGAGAGATGGATCTTCAGTCCGAATTCGAGTGACGTGCTCGAG
AAGACTTCATTTGCTCCTGCTCGGCGACCAAAGTCCAAAAGTGGTCCATTAGGGCCTCCT
GGAAAATTTGGTGGACAATACTCATCTGTGTCATTGCTTGACAATGGGAGAGTTGGACAT
TTGACAGCAAACTCGCCTTTCTTGGCTGGAGTACTGATACCAGAACATTATTGTGGAGAG
AAAGATAACATTGGGAGGTATATGAGCAGAACAGCTGGTGAGGAGGCCAGCATTGGCATT
GGAGGCAAGTCTTGTCTGGCAAATGGTGGGTCTCATGCTACTCAATATAACAGAGTTCGT
CGACGACTGGATACTGCGATTGAGTCATCACCTTCATTGCCTAGCACCCAAGCGTCTGTA
CAAGATGAACAGGTTGGAATCACAGAAGAGTCAGCCTCCATTATCACCCCTATAATTTTG
CGGAAGGATGCGGCAACTCAAACAAGCCCAAATCTAAGTCGGTCATCTTCGCCCAGTGTC
AGTACTCCATTTATCCATTTGCTTACGACACACCAAGTCAGAGAAAAGGAGAATTGTTTC
TCTGATGTTATCAGGGATGTGCACATGGACGATCGAGTGACTCTTACCAGGTGGTCCAAG
AAACATGTTACACGAGCATCTAGCAAGAACTCAACAAATGTTATAGATGTGAAGAAAAAG
ACAGTGGAGTCTAAGTCTTCTTCCTGGGAATTAACAGAAGCAAAATCCATATCAAAGGTT
GAGCGAGAGCAAGAAAAAATTACTGCTTGGGAACACCTCCAAAAAGCCAAGGCTGAGGCA
GCAATCCAAAAGTTAGTGATGAAAATCGAGAAAAAGAGATCATCTTCACTGGACAAGATT
TGGAACACCCTCAGGTCTGCACAAAGAAGAGCACAGGTAATGCGTGAAACTGCAGCAGCA
AACCAGGATGAGCAATCTTCCGGGAAGGCTAAAAGGACATCACACCTTAATAAGAACGGC
CAGATCAGCTCTCTGAGTGGCTGCTTCACTTGCCATGCCTTCTAG

Protein

515 aa

>Os09t0456100-02 Hypothetical conserved gene.
AFAEPHDEEEGDEVLCGVVEGDWAQLQEPTKSPADRTTGECLYQRRRSEAVLLQGRKGLK
QRPASLDFGSGSPGFNGAPLSPGFVVGGVGLMNKGLVSSSFIRSDVFPSPRTPNYRRHRS
SVFGYQKGWSSERVPLASKGNRRYPGSSMAFPFSNGRTLPSKWEDAERWIFSPNSSDVLE
KTSFAPARRPKSKSGPLGPPGKFGGQYSSVSLLDNGRVGHLTANSPFLAGVLIPEHYCGE
KDNIGRYMSRTAGEEASIGIGGKSCLANGGSHATQYNRVRRRLDTAIESSPSLPSTQASV
QDEQVGITEESASIITPIILRKDAATQTSPNLSRSSSPSVSTPFIHLLTTHQVREKENCF
SDVIRDVHMDDRVTLTRWSKKHVTRASSKNSTNVIDVKKKTVESKSSSWELTEAKSISKV
EREQEKITAWEHLQKAKAEAAIQKLVMKIEKKRSSSLDKIWNTLRSAQRRAQVMRETAAA
NQDEQSSGKAKRTSHLNKNGQISSLSGCFTCHAF*

5'UTR

chr09:17184097..17184097 (+ strand) : 1 bp

CDS

chr09:17184098..17184215 (+ strand) : 118 bp

chr09:17184297..17185082 (+ strand) : 786 bp

chr09:17185394..17185745 (+ strand) : 352 bp

chr09:17186118..17186199 (+ strand) : 82 bp

chr09:17186407..17186613 (+ strand) : 207 bp

3'UTR

chr09:17186614..17186631 (+ strand) : 18 bp

chr09:17187564..17188315 (+ strand) : 752 bp

FASTA

>Os09t0456100-02 class=Sequence position=chr09:17184097..17188315 (+ strand)
AGCATTCGCC GAGCCACACG ACGAGGAGGA GGGGGACGAG GTGTTGTGTG GGGTGGTGGA AGGGGACTGG GCACAGCTGC
AAGAACCAAC CAAGAGTCCG GCAGACCGTA CCACCGGAGG TACGAATTCT GAAACTTTGC ATGGAAAAAT TTAGATGGTA
CTCGGTTGTT CATTTTGTAT GCTTGTGTGG TGCTCGACAG AATGCCTGTA CCAGCGGCGC CGGTCAGAAG CTGTTCTTTT
GCAGGGTAGG AAGGGGTTGA AGCAACGGCC AGCCTCTCTG GACTTTGGCA GCGGCAGCCC CGGGTTCAAT GGAGCCCCTC
TTTCTCCGGG CTTTGTGGTT GGGGGTGTGG GTTTGATGAA CAAGGGTCTT GTGTCATCAT CATTCATCAG ATCAGACGTT
TTTCCTAGTC CCAGGACACC GAACTATCGG CGGCATCGTT CATCAGTATT TGGTTACCAA AAGGGGTGGA GCTCTGAGAG
AGTACCGCTT GCTTCCAAAG GTAACAGGAG GTACCCAGGC AGCAGCATGG CATTTCCCTT CAGCAATGGG AGGACATTGC
CCTCCAAATG GGAGGATGCA GAGAGATGGA TCTTCAGTCC GAATTCGAGT GACGTGCTCG AGAAGACTTC ATTTGCTCCT
GCTCGGCGAC CAAAGTCCAA AAGTGGTCCA TTAGGGCCTC CTGGAAAATT TGGTGGACAA TACTCATCTG TGTCATTGCT
TGACAATGGG AGAGTTGGAC ATTTGACAGC AAACTCGCCT TTCTTGGCTG GAGTACTGAT ACCAGAACAT TATTGTGGAG
AGAAAGATAA CATTGGGAGG TATATGAGCA GAACAGCTGG TGAGGAGGCC AGCATTGGCA TTGGAGGCAA GTCTTGTCTG
GCAAATGGTG GGTCTCATGC TACTCAATAT AACAGAGTTC GTCGACGACT GGATACTGCG ATTGAGTCAT CACCTTCATT
GCCTAGCACC CAAGCGTCTG TACAAGGTAT TATAAATTAT TCTCGTTTGC AATTCATTCC TTTTCTGCCT GCCTTTCAGT
TTTGAGTTGA TCCATAATTG TTCTGAAGGC AGCCTGGTGT TTTGAGGTAT CCTCTCTATT TGCCAAAGCA TCTCAATACT
GTGGAGTTTC TCATGGCCTT GCCACTGTAA ATGATGTTTT TTTTGTCAAT TAGTGTTTTG ATAGCTGGTT TTATCCTTGG
ATCGTCAACA TAACATCATA GAAAGTTAGT CTTATTCTGT ACACAACAGA TCAAGTCAGT CTTATGTTTG TACCTTCTTG
TTTGGTTTCT GATTCAGATG AACAGGTTGG AATCACAGAA GAGTCAGCCT CCATTATCAC CCCTATAATT TTGCGGAAGG
ATGCGGCAAC TCAAACAAGC CCAAATCTAA GTCGGTCATC TTCGCCCAGT GTCAGTACTC CATTTATCCA TTTGCTTACG
ACACACCAAG TCAGAGAAAA GGAGAATTGT TTCTCTGATG TTATCAGGGA TGTGCACATG GACGATCGAG TGACTCTTAC
CAGGTGGTCC AAGAAACATG TTACACGAGC ATCTAGCAAG AACTCAACAA ATGTTATAGA TGTGAAGAAA AAGACAGTGG
AGTCTAAGTC TTCTTCCTGG GAATTAACAG AAGCAAAATC CATATCAAAG TAAGAGACCA CCAATTGTTT TGGTCCTACA
GATGAGTTTG AGTAGCATTT TCTTCGGACA TAACTTTATT ATGTTGAACC ACTAAATTAC TAACAGAAGC AAAATCCATA
TCAAAGTAAG AGACCACCAA TTGTTTTGGT CCTTCAGATG AGTTTGAGTA GTATTTTCTT CAGACATAAC TTTGTTACGT
TGAACCACTA AATTACTACT ATAAGACTTG AAAGATTAAT TTAGGGAAAG AATGCTGCAT GTCTTTCTTA TCTGTTATAG
TACGCAAGTT ATCCAATGCT TTTAATATTT TCCAAAAACT TGCAACTTAA ATTTACACCA TCAAGCCGTG AAATGCTAAT
CACTCCATGC AATGTTAAAA GGGTTGAGCG AGAGCAAGAA AAAATTACTG CTTGGGAACA CCTCCAAAAA GCCAAGGCTG
AGGCAGCAAT CCAAAAGTTA GTGGTATGTG TGCTCTTTTC TTTACTTCTT TACTTCTAAC AGATTTATAG GTCTGTTTTA
TCGGACTTAT TTATGTTGTT GTAAAGAGCC TATATACTGT ATACACGACC AAAATTCTCA AAGTTAAATC AACGCTCATG
TAAATCACTG GATTCTTTTC CACTGATGTA CATTTGACCT TACACTATAC GCATGCTTTT GTTATGTCAG ATGAAAATCG
AGAAAAAGAG ATCATCTTCA CTGGACAAGA TTTGGAACAC CCTCAGGTCT GCACAAAGAA GAGCACAGGT AATGCGTGAA
ACTGCAGCAG CAAACCAGGA TGAGCAATCT TCCGGGAAGG CTAAAAGGAC ATCACACCTT AATAAGAACG GCCAGATCAG
CTCTCTGAGT GGCTGCTTCA CTTGCCATGC CTTCTAGTGT CATGTAGTTT AAGAAGTGAG TAAGTTACAT TCTGACTCCT
GTGATACTTT AAATGTTTTT TGATGAATTC TGCAGTGTTT CCTGTTTTAA TAACATTATA CCTGTTAGGA TTTTTTTCAC
AGTACACCAA AATTGTTTAG ATAGTTCATT TAACACTGGT CCAACGCTTG ATAATACTAT TACCTCCTAC AGGATCTAAC
TGTTAACATT ACAGCAGTAT CATTATTGAG ATCTAACAGT TGCAACTGGG AGAATTATGT AAAGAATAAA TTCCCCAGTA
CCCTCTTCTG AGTATCATCG AGGGGAACAA TTACATTTAT TTTAGAGCAC CGATGATGCG TGCATATTAT TTTAGTTTAT
TTCACCTACC TTGATGTAGA TATTTTTTTT TTTGTAACTG CATACCATTC ACTCAAATAA CTTTTCAGAA TTATGTTATG
CTCTATGACA TATTCCATGT TTCAAACCAA TTATTCAGAT TACGTAGATC CTAAAGGTAT ACCTGTATTC ATAAACTTCT
TCGATGCAAC TAGCGGATTG ACCTTTAGTG GAGGGGTACC AGCTTAGGTT GTACAGTCAG CATTATCCTA CTAAATTGCC
TCAAATTTAT TTAGGTCCTT CTTAAATAAG TAATCATACA CATCTGTCTT CTAATTAACA TTGATAGAAT TCTTGTTAGT
ATGCTGAAGA CGTGAACAGT TTGCTACTGT TTACCTTGTA ATGTTTTGAG GAAAATCGAC AATATTATGA TAACAAAAAG
GGGTCAATTA TTAGCATGCG TACTAATATA TTTCCTGTAA TCTGTGGCTG TCTGATACCA CATGTTTACC CTTTTACTGT
TGATGCCCCA CAACTTCCAT ATCGGCTCAA TAATTAGGCA ACATTTCAGT GAACCAAATA TTCCATGCAT GCTTATGTTT
GTACATCAAA ACTTTTGTCA TGTTCAGGGA ACAGGACTTA AAGTAATTCT TCGTGTTATC AACACGCTCG TGTTGACTTA
GTGAAGTTCA GAGATTTACA GAATAAAGAT GATCCAGCAG ATGGAAATTA TCCCCCCTTG AATTTTGACA AGATGCTGCT
GCAACAATGG GGGACCATGC ATTATCATGA TATAGATTTC TACAGTTCTG CTTTGTGTTA GTTTCGATTC TGCCATGGGG
GGACAAGAGA AAATGGTGCC ACGAAGGAAA GGTGAAATTC TTCTGCATAC ATCCCATGTG CCTGATTGAT ATCTTAGCAC
AATGATAATT GATAAGGTCC TCCTCTATCA TTCATTACCC ATTACCAACA TTCTAGATGC TATGAGTTTG TGTGCGATGA
AAACAAAGCA GATATGTATC ATTTGCACCA CAATTCCAAC GGATAGATAA GAAGGGAATG TTTCAGTCAG AGGGAATACA
GTGCCTTACT GTGATTCATG CTGGAAAACT CTACTGGATT GTGAAAGGGA ACCAGGTGGA ATGCAATAGA TTTAGCTAGC
GTATGCTACA TTTGCATACA CAGTTACAAT AGCATGTGTT GGAGAAAAAT ATAGGAATAC AGGAAAATAG AGATTCTGTT
TGAATTTCAT GGCAATTTGA CAAGCTCTTC GCAGAACAAC TCTCCCATTT CTGTAATGAG CTGTTTCTTG TAATTCCTAT
TGCAACACAT AGGCGTTACT GAATGTTGAT AAATGATATT GCCATCGCAA TTTTTTTTT

Locus: Os09g0456100

Loading...

Locus: Os09g0456100

Loading...