Os09t0459900-01

Locus

Os09g0459900

Description

Similar to Cyclin-dependent kinase inhibitor 6.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

KRP6

CGSNL Gene Name

KIP-RELATED PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

OsiICK4, Orysa;KRP6, OrysaICK4, Orysa;ICK4, OsKRP6

Oryzabase Gene Name Synonym(s)

Cyclin-dependent kinase inhibitor 4, KIP-related protein 6, inhibitor of cyclin-dependent kinase 4

Transcript Evidence

AK111010 (DDBJ, Best hit)

Protein Evidence

B9G407 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-174-F09 (Online Clone Ordering)

Expression Databases

TENOR (Os09t0459900-01)

RiceXPro (AK111010)

Others

Oryzabase (12357)

KEGG (Os09t0459900-01)

Transcript

917 bp

>Os09t0459900-01 Similar to Cyclin-dependent kinase inhibitor 6.
CCTATCGTTATCTCCTCCCGTCCCATCCAACCCCGCCCCGTAATACCCCCCCTCCATAAC
ACCCACTGCCACGAGCCCACGACCGCATTAGCATTAGCATTAGCATAAGGGAGGGAGGGA
GGGAGGGATCATTAGAGGAGGAGCACAGCACATGGCTGCCGCGGCCGCCACCGTGACGGC
GGTGCAGCCAGCGGCGTCGAGCTGCGGCAAGCGCGACGGCGACAATGCGTGCGTCGTCGA
CATGTGCGCCTCTCTCAATCTTCCCCGTCGTCCCTTCTTCCTCTTCCTGACATGTTATCA
CGTCACGCGCGTGCGTTCACTGCAGGCCCAGGAAGGCGAAGAAGGGGAGGTCGCCGCCGG
AGGAGGAGGTGGAGGCCTTCCTCGCCGCGGCGGAGAGCAGCGTGGCGCGGCGCTTCGCGG
CCAAGTGAGTACTAAGTACATTACGGCAGCATCGCACGGTGACATCGTCTCAGCGCGAGC
GAGCTGTGGCCTTTCTGTGACCGTAAGGTTTGGTTTTCTCGGGGATTTATATAGCTATAG
CCCTTGCACTCGCAGCATCGGCACGGCAGTGGGCCTGTAAAATTTTCCGCTGCTGCTGAA
GCTCGCGAAGTGCAGCTTGTCAGTGTGGTGTTGTTGCACTCGCAGACAGTAAAAACGCCA
AATGGGGTTACTGTACATGCCTCTGGGCTTGTGGTTTCCTCTGTATTTTTCTCTTGCTTT
TTGTATGCTTAGGCACCgtttagatcccgaacttttttttttcaaacttttaacttttct
gtcacatcgaattttcttacacacataaatttttaaatttttctttacatcgttctaatt
tctttaaacttttaattttgacgtggaactaaacacagcctTATTCTATTATGCCAAATG
GAGTTCTGCTTTTTTGG

CDS

429 bp

>Os09t0459900-01 Similar to Cyclin-dependent kinase inhibitor 6.
ATGGCTGCCGCGGCCGCCACCGTGACGGCGGTGCAGCCAGCGGCGTCGAGCTGCGGCAAG
CGCGACGGCGACAATGCGTGCGTCGTCGACATGTGCGCCTCTCTCAATCTTCCCCGTCGT
CCCTTCTTCCTCTTCCTGACATGTTATCACGTCACGCGCGTGCGTTCACTGCAGGCCCAG
GAAGGCGAAGAAGGGGAGGTCGCCGCCGGAGGAGGAGGTGGAGGCCTTCCTCGCCGCGGC
GGAGAGCAGCGTGGCGCGGCGCTTCGCGGCCAAGTGAGTACTAAGTACATTACGGCAGCA
TCGCACGGTGACATCGTCTCAGCGCGAGCGAGCTGTGGCCTTTCTGTGACCGTAAGGTTT
GGTTTTCTCGGGGATTTATATAGCTATAGCCCTTGCACTCGCAGCATCGGCACGGCAGTG
GGCCTGTAA

Protein

143 aa

>Os09t0459900-01 Similar to Cyclin-dependent kinase inhibitor 6.
MAAAAATVTAVQPAASSCGKRDGDNACVVDMCASLNLPRRPFFLFLTCYHVTRVRSLQAQ
EGEEGEVAAGGGGGGLPRRGGEQRGAALRGQVSTKYITAASHGDIVSARASCGLSVTVRF
GFLGDLYSYSPCTRSIGTAVGL*

5'UTR

chr09:17392480..17392630 (- strand) : 151 bp

CDS

chr09:17392051..17392479 (- strand) : 429 bp

3'UTR

chr09:17391714..17392050 (- strand) : 337 bp

FASTA

>Os09t0459900-01 class=Sequence position=chr09:17391714..17392630 (- strand)
CCTATCGTTA TCTCCTCCCG TCCCATCCAA CCCCGCCCCG TAATACCCCC CCTCCATAAC ACCCACTGCC ACGAGCCCAC
GACCGCATTA GCATTAGCAT TAGCATAAGG GAGGGAGGGA GGGAGGGATC ATTAGAGGAG GAGCACAGCA CATGGCTGCC
GCGGCCGCCA CCGTGACGGC GGTGCAGCCA GCGGCGTCGA GCTGCGGCAA GCGCGACGGC GACAATGCGT GCGTCGTCGA
CATGTGCGCC TCTCTCAATC TTCCCCGTCG TCCCTTCTTC CTCTTCCTGA CATGTTATCA CGTCACGCGC GTGCGTTCAC
TGCAGGCCCA GGAAGGCGAA GAAGGGGAGG TCGCCGCCGG AGGAGGAGGT GGAGGCCTTC CTCGCCGCGG CGGAGAGCAG
CGTGGCGCGG CGCTTCGCGG CCAAGTGAGT ACTAAGTACA TTACGGCAGC ATCGCACGGT GACATCGTCT CAGCGCGAGC
GAGCTGTGGC CTTTCTGTGA CCGTAAGGTT TGGTTTTCTC GGGGATTTAT ATAGCTATAG CCCTTGCACT CGCAGCATCG
GCACGGCAGT GGGCCTGTAA AATTTTCCGC TGCTGCTGAA GCTCGCGAAG TGCAGCTTGT CAGTGTGGTG TTGTTGCACT
CGCAGACAGT AAAAACGCCA AATGGGGTTA CTGTACATGC CTCTGGGCTT GTGGTTTCCT CTGTATTTTT CTCTTGCTTT
TTGTATGCTT AGGCACCgtt tagatcccga actttttttt ttcaaacttt taacttttct gtcacatcga attttcttac
acacataaat ttttaaattt ttctttacat cgttctaatt tctttaaact tttaattttg acgtggaact aaacacagcc
tTATTCTATT ATGCCAAATG GAGTTCTGCT TTTTTGG

Locus: Os09g0459900

Loading...

Locus: Os09g0459900

Loading...